SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009494 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009494
Domain Number 1 Region: 455-619
Classification Level Classification E-value
Superfamily PH domain-like 2.32e-57
Family Phosphotyrosine-binding domain (PTB) 0.0000000494
Further Details:      
 
Domain Number 2 Region: 633-756
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-21
Family PDZ domain 0.0000304
Further Details:      
 
Domain Number 3 Region: 748-811
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000184
Family PDZ domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009494   Gene: ENSMPUG00000009571   Transcript: ENSMPUT00000009650
Sequence length 832
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897043.1:4561777:4750637:1 gene:ENSMPUG00000009571 transcript:ENSMPUT00000009650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNHLEGSAEAEVTDEAAGGEVNESVEADLEHPEVEEEQQQPPPPPQQRYAGRPGRGRAVE
DPRAQPGQPEEEERGESLARSASTESGFHNHTDTAEGDVIAAARDGYDAERAQDPEDESA
YAVQYRPEAEEYTEQAEAEHAEATHRRALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHR
GEDEPYAEPYADYGGLQEHVYEEIGDAPELEARDGLRLYEQERDEAAAYRQEALGARLHH
YDERSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKAAKDMPEAE
QDLERAPTPGGGRPDSPGQQAPAGQQRVAGPAPGEAGQRYSKEKRDAISLAIKDIKEAIE
EVKTRTIRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPVDGDSPSPGSSSPLGAESSSTP
LHPSDPAEASSNKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLSDKTPS
KNVRMMQAQEAVSRIKMAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADSQETMM
DHPLRTISYIADIGNIVVLMARRRLPRSNSQENVEASHPSQDGKRQYKMVCHVFESEDAQ
LIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMYNDDLIHFSKSENCKDVF
IEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLP
LSTCQSIIKGLKNQPRVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICSLMRGGIAE
RGGVRVGHRIIEINGQSVVATPHEKIVHILSXXXXXXXXXXXXXKKKINKAG
Download sequence
Identical sequences M3YDT7
ENSMPUP00000009494 ENSMPUP00000009494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]