SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009502 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009502
Domain Number 1 Region: 162-255
Classification Level Classification E-value
Superfamily PH domain-like 5.48e-29
Family Pleckstrin-homology domain (PH domain) 0.0000049
Further Details:      
 
Domain Number 2 Region: 28-132
Classification Level Classification E-value
Superfamily SH2 domain 4.04e-27
Family SH2 domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009502   Gene: ENSMPUG00000009579   Transcript: ENSMPUT00000009658
Sequence length 280
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896920.1:15780290:15827814:-1 gene:ENSMPUG00000009579 transcript:ENSMPUT00000009658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAESLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLL
RDSNESTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETG
TLIVLKHPYPRKVEEPSIYESVRVHTAMQTGRTESDLVPTAPSLGTKEGYLTKQGGLVKT
WKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLC
AKTGVEADEWIKILRWKLSQIRKQLDQREGTIRSRSFIFK
Download sequence
Identical sequences M3YDU5 U6CSV3
ENSMPUP00000009502 XP_012909509.1.14098 ENSMPUP00000009502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]