SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009530 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009530
Domain Number 1 Region: 18-111
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000398
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000009530
Domain Number - Region: 169-227
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00252
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009530   Gene: ENSMPUG00000009606   Transcript: ENSMPUT00000009686
Sequence length 270
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897010.1:413282:433563:1 gene:ENSMPUG00000009606 transcript:ENSMPUT00000009686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCANDVFQASNP
LWQSRGSTTVSSGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESSRPSHHHT
TTFDIKQLKNYIIHKHASTLLGWLQAISISGMAALMMGRQSELSDGIAMLVAGNDRVQAV
ITQMEEVCQTIEDNSRRQKQLLNQRFEALCSVLEERKAELLQALAREQEEKLLRVRGLIR
QYGDHLEASSKLVESAIQSMEEPQMALYLQ
Download sequence
Identical sequences M3YDX3
ENSMPUP00000009530 ENSMPUP00000009530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]