SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009546 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009546
Domain Number 1 Region: 138-298
Classification Level Classification E-value
Superfamily PH domain-like 2.77e-34
Family Pleckstrin-homology domain (PH domain) 0.0000551
Further Details:      
 
Domain Number 2 Region: 2-116
Classification Level Classification E-value
Superfamily PH domain-like 1.64e-22
Family Pleckstrin-homology domain (PH domain) 0.00000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009546   Gene: ENSMPUG00000009622   Transcript: ENSMPUT00000009702
Sequence length 425
Comment pep:known scaffold:MusPutFur1.0:GL896962.1:983362:1043704:-1 gene:ENSMPUG00000009622 transcript:ENSMPUT00000009702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYVDRQNRICGFLDIEEHENSGKFLRRYFILDTQANCLLWYMDNPQNLAMGAGAVGSLQ
LTYISKVSIATPKQKPKTPFCFVINALSQRYFLQANDQKDLKDWVEALNQASKITVPKVG
SLPLTTEVIKSLPAPPALEKKPQVAYKTEIIGGVVVHTPINQNGGDGQEGSEPGSHAILR
RSQSYIPTTGSRVPSGPPLIKSGYCVKQGNVRKSWKRRFFVLDDFTISYFKCEQDREPLR
TIFLKDVLKTHECLVKSGDLLMRDNLFEIITSSRTFYIQADSPEDMHSWIKEIGAAVQAL
KCHPRDMSFSRSISLTRSGSSGLSGGPNSVLCRGRPLVEEKKALCKAPSVASSWQPWTPV
PQAGDKLLPAEETPGDSLFTPRLGESSTSGVLPSSRIRHRSEPQHPKEKPFLFSLDDESI
RTSDV
Download sequence
Identical sequences G9KH46
ENSMPUP00000009546 ENSMPUP00000009546 XP_004758264.1.14098 XP_012914718.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]