SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009654 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009654
Domain Number 1 Region: 53-160
Classification Level Classification E-value
Superfamily PH domain-like 2.71e-17
Family Pleckstrin-homology domain (PH domain) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009654   Gene: ENSMPUG00000009730   Transcript: ENSMPUT00000009810
Sequence length 273
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897030.1:3014516:3026668:-1 gene:ENSMPUG00000009730 transcript:ENSMPUT00000009810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQALWGTQSARAAGWVASASSSGGFGSSIRKRCGQVPPDPTLESPFEEMALVRGGWLWR
QSSILRRWKRNWFALWLDGTLGYYRDETAQDEEDRVLIQFNIRDIKIGQECHDVQPPEGR
SRDGLLTVNLREGSRLHLCAETKDDAIAWKTALLEANSTPAPAGATVPPRNHRVCPKVRC
VTSSWSPCKVERRIWVRVYSPYQDYYEVVPPNAHEATYIRSYYGPPYAGPGVTHVVVRED
PCYSAGAPLAMGMLAGAATGAALGSLMWSPCWF
Download sequence
Identical sequences M3YE97
ENSMPUP00000009654 ENSMPUP00000009654 XP_004768150.2.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]