SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009664 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009664
Domain Number 1 Region: 1139-1318,1368-1413,1447-1626
Classification Level Classification E-value
Superfamily Ras GEF 7.72e-58
Family Ras GEF 0.001
Further Details:      
 
Domain Number 2 Region: 365-499
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000226
Family Protein kinases, catalytic subunit 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000009664
Domain Number - Region: 42-134
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00484
Family Protein kinases, catalytic subunit 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009664   Gene: ENSMPUG00000009740   Transcript: ENSMPUT00000009820
Sequence length 1667
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897343.1:124227:177542:-1 gene:ENSMPUG00000009740 transcript:ENSMPUT00000009820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSVAHTAIFQTLCITPDTLAFNTSGNVCFMEQLSDDPEGAFVPPEFDVTGNTFEAHIYS
LGATLKVALEYVTDPELEPRLSQDLEVLLSRMQAEDPRDRPDLEAIIALCEEKMLFTSSC
RLCRSLSAVGRRVLSIESFGTFQDVTESTWSGKPATGSMGPRRPTGGQAVDPGSVPQRPA
QEAQGSPKQPAAQPSKPLLSAPVRNGEQLASLLLDSQHPPGDMERRCLRKVQTFPKLPPD
GPEPSTLCLTLTPAKNQPPIPQVFPPDLSKASLDGKNGLSSYKSEPDSRLLPGREPELQQ
GEPGDASQSGDRACGALGWSPVEQSAPPRCEDPGDAGREPKTCRAEEGSAGRAGEPASAT
AEQVISLRQLLRQLGRPFKECELWALSHTCLTALRAHHEHPACLCLDSVLVAEDGAVLFS
PPPANGTYDSFFLAPEVAEQELVTEKASVYAVAAVLWTAAKFSVPQNHKLALPRRLKTFL
LDMARRSAQERPHTAEAIKTCSTYLRQRGMDSRRILAHLRASTHKAGRGLPEQADQEEET
IGLQNALSVGKLSPSMTPASGPSSGFVGVSRDPRLVAVQGPVPTQPPGTEGATLLPAAFT
AAATHFRPIVLAPDAEDARDREDDGRQAPEAPGAASWTMPDQPAPGAGPQGAAPEPPRES
TPRDKAQGIPCVPAPGPDGASPVMPESSADVRLLKAQALPTEEGSSVTRRDPSHPAKPPR
SKATKGPGQEPEGRSSAPWDPSLAKASPDSPKGTSVPEQDDQATDSHPERPLPADCKLGV
PSVDASPLPKRTACPSLQEATRLIQEEFAFDGYLDNGLEALIMGEYIYALKDLTYATFCG
AISEKFCDLYWGEKLLQSLFKVVNGRTSPSENASEEAGAEPEGSAAGTPSGCLLSSQRPS
LHRTGKETPAMARGSRAPGPSPSMSDVDADELSRGNFEVGFRPQKSVKGEREQQPEAGEH
GQQGGGPSPEAVARLARPKEGGLAAHPGPAELQSCSPGWCSAFYEADCFGADVYSYVKEL
ARQKAGGAPDADAQSLTSLLEPECRQELEQQLLMEKRNHRKTLKFYQKLLQKEKRSKGSE
VKTMLSKLRGQLEEMKCKVQFLGLVKKYLQVMYAERWGLEPCALPVIVNISAAHCDTLDF
SPLDESSSLIFYNVSKHPRGGKQRKARVLQAGTPLGLMAYLYSSDAFLEGYVQQFLYTFR
YFCTPQDFLHFLLDRINSTLSRAHQDPTSTFTKIYKRSFCLLQAWLEDCYAVDFTRNSGL
LSRLEDFISSKILPLDGSAEHLLGLLEVGTDRRAEGSLRGTDLEDPKEAEDDARPLNALC
KRLSEDGISRKSFPWRLARGNGLALPHKERQYTIASALPKPCFFEDFYGPYAKANEKGPY
FLTEYSTHQLFSQLTLLQQELFQKCHPVHFLNSRALGVMDKSVAIPKAGSSDSLSAKTCS
LFLPSYVQDKYLLQLLRSADDVSTWVAAEIVTSHTSKLQVNLLSKFLLIAKSCYEQRNFA
TAMQILGGLEHVAVRQSPAWRILPAKIAEVMEELKAVEVFLKSDSLCLMEGRRFRAQPTL
PSARLLAMHVQQLETGGFTMTNGAHRWSKLRNIAKVVSQVHAFQENPYTFAPDPKLQSYL
KQRIARFSGADISILAADNRASFHQISNEKHSRKIQDKLRRMKATFQ
Download sequence
Identical sequences M3YEA7
ENSMPUP00000009664 XP_012906134.1.14098 ENSMPUP00000009664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]