SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009722 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009722
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily RING/U-box 2.08e-38
Family RING finger domain, C3HC4 0.00000543
Further Details:      
 
Domain Number 2 Region: 547-651
Classification Level Classification E-value
Superfamily BRCT domain 5.5e-27
Family BRCT domain 0.00000322
Further Details:      
 
Domain Number 3 Region: 655-753
Classification Level Classification E-value
Superfamily BRCT domain 3.93e-22
Family BRCT domain 0.00000578
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000009722
Domain Number - Region: 245-316
Classification Level Classification E-value
Superfamily Prefoldin 0.0191
Family Prefoldin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009722   Gene: ENSMPUG00000009796   Transcript: ENSMPUT00000009879
Sequence length 766
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897072.1:3040962:3106943:1 gene:ENSMPUG00000009796 transcript:ENSMPUT00000009879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLPADRVEEVQNVLNAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQRKGPSK
CPLCKNDITKRSLQESTRFSQLVEELLKIIHAFELDTGLQFANSYNFSKKENNSPEHLKE
EVSIIQSMGYRNRAKRLRQNEPENPTLQETSLSVQLSDLGILRSLRTKQQIQPQNKSVYI
ELGSDSSEDTVNKASYCSVRDDELLQITPQGSRTEASLNPAKKAACEISEDITNSERHQS
DNKDLTTTEKHATEKHPEKYQGEVASGYQSETSFSEDCSRLSSQSDILTTQQRDTMQDNL
IKLQQEMAELEAVLEQHGSQPSRSSPSPVAGSCAPEDLLDPEQNTSEKAVLTSEKSSDYP
KSQNPESLSADKYQVSLDSSTGKNKEPGTRRSSPSQSRLLDTRWYVHSCPRSLQDTDCPS
QKELIKVVSVEEQQASRSEARDFMEQPYLPRPDLEGTPYLESGISLFSDDPESDASTDRA
PEPAHVSRMPAATSALKLPQFQVEESAKSTAAVHIANTAGYNKREDSVGREKPEVISSIK
RVNRRISMVASGLTPKECMLVHKFARKHHITLTNQISEETTHVIMKTDAEFVCERTLKYF
LGIAGGKWVVSYFWVTQSIKERKMLDEHDFEVRGDVVNGRNHQGPKRARESRDRKIFRGL
EVCCYGPFTNMPTDQLEWMLRLCGASVVKEPSLFPLSKGAHPVVVVQPDAWAEDSGFHAI
GQMCEAPVVTREWVLDSVALYQRQELDTYLIPQIPRAAAHSSQPCV
Download sequence
Identical sequences M3YEG5
ENSMPUP00000009722 ENSMPUP00000009722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]