SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009729 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009729
Domain Number 1 Region: 120-338
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.29e-46
Family Tyrosine-dependent oxidoreductases 0.0041
Further Details:      
 
Domain Number 2 Region: 12-49
Classification Level Classification E-value
Superfamily WW domain 0.00000000000106
Family WW domain 0.0011
Further Details:      
 
Domain Number 3 Region: 56-91
Classification Level Classification E-value
Superfamily WW domain 0.0000000000797
Family WW domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009729   Gene: ENSMPUG00000009803   Transcript: ENSMPUT00000009886
Sequence length 462
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896939.1:9044958:9345699:-1 gene:ENSMPUG00000009803 transcript:ENSMPUT00000009886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALRYAGLDDTDSEDELPPGWEQRTTKDGWVYYANHAEEKTQWEHPKTGKRKRIAGDLP
YGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTSRQRYDGSTTAMEILQGR
DFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAM
TLDLALLRSVQHFAQAFKAKNLSLHMLVCNAAAFALPWSLTKDGLETTFQVNHLGHFYLV
QLLQDVLCRSAPARVVVVSSESHRFTDISDSSGKLDFSRLSPSKNDYWAMLAYNRSKLCN
ILFSNELHRRLSPRGVTSNAVHPGNMMYSSIHRNWWVYTLLFTLARPFTKSMFFMWMTLE
IAGEKLMCFLPCTTSASWGCKSPFLLSVVPTARAYFPVGRAGRRMLAPLHSPPWQLGGCG
TVPASKYQQKSSQAFSETFCSWMKGRAAGIVCPPFFPCAVWI
Download sequence
Identical sequences M3YEH2
ENSMPUP00000009729 ENSMPUP00000009729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]