SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009730 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009730
Domain Number 1 Region: 650-927
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.31e-92
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000105
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000009730
Domain Number - Region: 351-394
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0824
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009730   Gene: ENSMPUG00000009804   Transcript: ENSMPUT00000009887
Sequence length 953
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897015.1:5369193:6037797:-1 gene:ENSMPUG00000009804 transcript:ENSMPUT00000009887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTHRYEVSPGALQHLTATLQKLSRTGFTWQDGYTQRVMAQELSDLPHAYPRHLDASDTA
RSLERSAEKERRSSLQEAGALARAVQRYLPYLEALSQAAAPNAHPVTRLDRPAAQGEDPR
ADGVLTFTAQTAALTYAPGPWAEHPGSRPLGTRGRLQPDELSPKVDGGAERQSPVAALVT
AVARKPPALHREDDPGPRHRLRGPWKTARVLSAPAALRKWSLPPGDPEDPPALGDETLIR
SLLKDLGRQPAPAEGLSPLELSEMAHMVAAAVQGAGADGELRGAEKGAAGKPREASVREQ
AGDSGADDRGPDGGGGADEEVSHLGLRLGDHLQHPRPQLFPAAPVLMEPFKTEMKKSETP
KVPLTWEEESAGVEDVRSQTYSKDWLDRPRPAQPQGRGSGELQAWVPGPSQEDAGLEARA
RGRPSESLWLAARPSQEEEGYIVTGNDPLSPEKGKELMESVARLLEVPMSVFAEIAVLGP
AVTFRVSASVRNLTAADVAQATADGKDELERASGLKIVRAGSGSKSKLRVLPHGAEQEDS
TPFIVLTLVSVVAMVGVLLASAVIYCLRHASHSRLQEKLSGLGEHPGPDATAAYQELCRQ
RMAVRTSERPEAPHASRVNSVSSQFSDGPMPSPSARSSTSSWSEEPVQSNMDISTGHMVL
AYMEDHLKNKNRLEKEWEALCVYQAEPNSSLVAQREENVPKNRSPAVLTYDHSRILLKSE
NSHSNSDYINASPIMDHDPRNPAYIATQGPLPATVADFWQMVWESGCVVIVMLTPLSENG
VRQCYHYWPDEGSNLYHVYEVNLVSEHIWCEDFLVRSFYLKNLQTNETRTVTQFHFLSWY
DQGVPSSARSLLDFRRKVNKSYRGRSCPIIVHCSDGAGRSGTYVLIDMVLNKMAKGAKEI
DIAATLEHLRDQRPGMVQTKEQFEFALTAGAGWMGRLRAHQQLHTLSGEHTAY
Download sequence
Identical sequences M3YEH3
ENSMPUP00000009730 ENSMPUP00000009730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]