SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009758 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009758
Domain Number 1 Region: 700-827
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.57e-30
Family Synaptotagmin-like (S variant) 0.0024
Further Details:      
 
Domain Number 2 Region: 272-396
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.05e-28
Family PLC-like (P variant) 0.021
Further Details:      
 
Domain Number 3 Region: 461-581
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.32e-20
Family Synaptotagmin-like (S variant) 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009758   Gene: ENSMPUG00000009832   Transcript: ENSMPUT00000009915
Sequence length 836
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897015.1:6203928:6284039:-1 gene:ENSMPUG00000009832 transcript:ENSMPUT00000009915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLGGQARGTRGDSAGQRPPPRAPPAPPFGRTVLRSPGTKTGGGGGGPARPPARGTQRGL
HSASPGPALTERPDREVHFPDTERAEWLNKTVKHMWPFICQFIEKLFRETIEPAVRGANT
HLSTFSFTKVDVGQQPLRINGVKVYTENVDKRQIILDLQISFVGNCEIDLEIKRYFCRAG
VQSIQIHGTMRVILEPLIGDMPLVGALSIFFLRKPLIEINWTGLTNLLDIPGLNGLSDTI
ILDIISNYLVLPNRITVPLVSEVQIAQLRFPIPKGVLRIHFIEAQDLQGKDTYLKGLVKG
KSDPYGVIRVGNQIFQSKVIKESLSPKWNEVYEALVYEHPGQELEIELFDEDPDKDDFLG
SLMIDLIEVEKERLLDEWFTLDEVPRGKLHLKLEWLTLMPNASNLDKVLTDIRADRDEAN
DGLSSSLLILYLDSARNLPSNPLEFNPDVLKKSAVQKALKSGKKINSNPNPLVQMSVGHK
AQESKIRYKTNEPVWEENFTFFIHNPKRQDLEVEVKDEQHQCSLGHLKIPLSQLLTSDDM
TMNQRFQLSNSGPNSTLKMKIALRVLHLEKQERSPDHQHSAQVKRPSVAKEGRKISLRSQ
KSASPGSGDSSTAPCTPVMGSSSKPGMEERTQPVEASPQGPRDLGRSSSSLQTGATCSPS
HVSVKEPTPSIASDISLPIATQELRQRLRQLENGTTLGQSPLGQIQLTIRHSSQRNKLVV
VVHSCRNLIAFSEDGSDPYVRMYLLPDKRRSGRRKTHVSKKTLNPVFDQSFDFSVSLPEV
RRRTLDVAVKNSGGFLSKDKGLLGKVLVGLASEELARGWTQWYDLTEDGTRPHVVT
Download sequence
Identical sequences M3YEK1
ENSMPUP00000009758 ENSMPUP00000009758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]