SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009769 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009769
Domain Number 1 Region: 560-915
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.94e-110
Family PDEase 0.00000219
Further Details:      
 
Domain Number 2 Region: 373-555
Classification Level Classification E-value
Superfamily GAF domain-like 5.45e-49
Family GAF domain 0.0000000626
Further Details:      
 
Domain Number 3 Region: 203-386
Classification Level Classification E-value
Superfamily GAF domain-like 3.05e-36
Family GAF domain 0.0000000212
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000009769
Domain Number - Region: 26-157
Classification Level Classification E-value
Superfamily GAF domain-like 0.00785
Family GAF domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009769   Gene: ENSMPUG00000009843   Transcript: ENSMPUT00000009927
Sequence length 920
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897030.1:3992900:4026189:1 gene:ENSMPUG00000009843 transcript:ENSMPUT00000009927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRAPGLCLSPPTPAPPPDPCGSAKQDALLSLGSVIHIAGFRRAVKEALSAVLPKVETVYT
YLLDGESRLVCEDPPHELPQEGKVREAVVSRKRLGCSGLGPTDLPGKPLARLMAPLAPDT
QVLVMPLVDKEAGAVAAVILVHCGQLSDSEEWSLQAVEKHDGGKEHRRTTEQRQRSPGGG
ERRTGGASDSLTXDQKGGVAYTDQDRKILQLCGELYDLDASSLQLKVLQYLQQETQASRC
CLLLVSEDNLQLSCKVIGDKVLQEETSFPLTTGRLGHVVEDKKSIQLKDLASEDVQQLQS
MLGCELQAMLCVPVISRATDQVVALACAFNKLGGDPFTDQDERVIQHCFHYTSTVLTSTL
AFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQNELV
AKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRN
ILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQ
YRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAILS
MLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELSNYL
EDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTH
GCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHSLLLC
LLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQIS
FMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYE
VPDLDGTRAPVNGCCSLDAE
Download sequence
Identical sequences M3YEL2
ENSMPUP00000009769 ENSMPUP00000009769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]