SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009831 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009831
Domain Number 1 Region: 102-315
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-60
Family DBL homology domain (DH-domain) 0.00000000253
Further Details:      
 
Domain Number 2 Region: 300-454
Classification Level Classification E-value
Superfamily PH domain-like 7.77e-48
Family Pleckstrin-homology domain (PH domain) 0.0000000535
Further Details:      
 
Domain Number 3 Region: 16-118
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-20
Family SH3-domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009831   Gene: ENSMPUG00000009906   Transcript: ENSMPUT00000009991
Sequence length 562
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897282.1:433684:640012:1 gene:ENSMPUG00000009906 transcript:ENSMPUT00000009991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQWIRGGSGMLITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDE
EGWFPASFVRLWVNQEDGVEEGPSDVQNGHLDPNSDCLCLGRPLQNRDQMRANVINEIMS
TERHYIKHLKDICEGYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNND
DPHLSEIGPCFLEHQDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDI
AIDGFLLTPVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQQINERKRRLEN
IDKIAQWQASVLDWEGEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKKD
LIRRDILYYKGRIDMDKYEVVDIEDGRDDDFNVSMKNAFKLHNKETEEIHLFFAKKLEEK
IRWLRAFREERKMVQEDEKIGFEISENQKRQAAMTVRKVPKQKGVNSARSVPPSYPPPQD
PLNQGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRRSKKNLKQFMETNENKDTSTQNL
WATAKAVLRGKYIAIKPPSKKN
Download sequence
Identical sequences M3YES4
ENSMPUP00000009831 ENSMPUP00000009831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]