SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009852 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000009852
Domain Number - Region: 419-491
Classification Level Classification E-value
Superfamily TPR-like 0.0092
Family Tetratricopeptide repeat (TPR) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009852   Gene: ENSMPUG00000009927   Transcript: ENSMPUT00000010012
Sequence length 1224
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896984.1:7015382:7071565:1 gene:ENSMPUG00000009927 transcript:ENSMPUT00000010012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWRRSYGRAPKMIHLESNFVQFKEELLPKEGNKALLTFPFLHIYWTECCDTEVYKATVK
DDLTKWQNILKAHSSVDWLIVVVENDAKKKNKTNILPRTSIVDKIRNDFCNKQSDRCVVL
SDPLKDSSRTQESWNAFLTKLRTSLLMSFTKNLGKFEDDMRTLREKRTEPGWSFCDYFMV
QEELAFVFEMLQQFEDALVQYDELDALFSQYVVNFGAGDGANWLTFFCEPVRSWNGLILR
KPIDMEKRELIQRQEATLLDLRSYLFSRQCTLLLFLQRPWEVAQRALELLHSCVQELKLL
EVSVPPGALDCWVFLSCLEVLQRIEGCCDRVQIDSNVAHTVGLWSYATEKLKSLGYLCGL
VSEEGPNSEDLNRIVDLLAGLGAERPETANTAQSPYKKLKEALSSVEAFEKHYLDLSHAT
IEMHTSVGRTRSARLVGKDLAEFYMRKKSPQKAEIYLQGALKNYLAEGWALPITHTRKQL
AECQKHLGQTENYLQTSSLLASDHHLTEEERKYFCQEILSFASRQTDSTGQKIVLPLHCF
AHLRDLHFTPSNAVVHVGGVLSVDITLCSQMPIPVRVEQIAINVHFSIEKNNYRKTAEWL
TKHKMANGVITFPAETSPLPAAQNNLPALELYEMFERSPSDNSLNTTGIVCKNVHMLLRR
QESGTALETPSGAALETPSGAALEGGAHALRCSDVTLEPGPNTITFRTQAKEPGTYTLRQ
LCASVGPVWFVLPHLYPLVQYDVYSQEPQLHVEPLADGLLAGIPQKVKFTVTTGHYTVKN
GDSLQLSNAEAMLVLCHAENRAVIYSNTREKASDVLLRVQSSDKVTSISLPAAPAYHMIE
FELEVLSLPSAPVTGGESSMLGTTEPHRKHKDTHRAGHCMATTDHKVSIDCPWSIYSTVI
ALTFSVPFRTTHSLLSAGTRKYIQVCVQNLSELDFQLSDGDLVDHGCGADLQLIPLNAKC
PQAIHSKQSVFFVWELLWAREPPPSLRCRFSVGFSPASEGQLSVPLKPYTYEFQVENFFT
LYNVKAEILPPSGTEHCRTGSLCSLEVSITRLSDLLEVDKDEALTETDEYLSTKLMYEVV
DNSSNWAVCGKSSGVISMPVAAQATHRVHMEVMPLFAGYLPLPDVRLFKYLPHHSAHSSQ
LDADSWIESDSLSLDKHLDDQPAPGTAAGPGLQLEHGHADPGHPQQRRPRPRSQCHMTTP
GVRTRPRPRVGAREGTLAPSLSPS
Download sequence
Identical sequences M3YEU5
ENSMPUP00000009852 ENSMPUP00000009852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]