SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009859 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009859
Domain Number 1 Region: 4-85
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-19
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009859   Gene: ENSMPUG00000009934   Transcript: ENSMPUT00000010019
Sequence length 867
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896939.1:11552155:11592971:1 gene:ENSMPUG00000009934 transcript:ENSMPUT00000010019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVPNVLAKALYDNVAESPDELSFRKGDIMTVLERDTQGLDGWWLCSLHGRQGIVPGNRL
KILVGMHDKKPAGPGPGPPAPAAQPQPGLHTPAAQYTPMLPAAYQPQPDSVYLVPTPSKT
QQGLYQAPGPSPQFQSPPAKQTSTFSKQMPHHPFPSPAPDLYQVPPGPGSPAQDIYQVPP
AAGIGHDIYQVPPSMDTRSWEGSKPPAKVVVPTRVGQGYVFEASQPEQDEYDIPRHLLAP
GPQDIYDVPPARGLLPSQYGQEVYDTPPMAVKGPNGRDPSLDVYDVPPSVEKGLPLSTHH
AVYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPTRHPLVLATPPPDSLAAEDVYD
VPPPAPDLYDVPPGLRRPGPGPLYDVPRERLLPAEAADGSVADDSVYAVPPPAEREPPSE
AKRLSASSTGSTRSSQSASSLEAAGPGREPLELEVAVEALARLQQAVSTTVAQLLDLAGS
AGTGGGWRCAPEPQELTGQDLRAAVAAVQGAVHELLEFARGAIGNAAHTSDRTLHAKLSR
QLQKMEDVYQTLVAHGQALEGGRGGAGTTPEDVDRLVACSRAVPEDAKQLASFLHGNASL
LFRRTKAPVGGPEGGGPLHPNPIDKASSIQSRPLPSPPKFTSQDSPDGQYENSEGGWMED
YDYVHLQGKEEFEKTQKELLEKGNIMRQGKGQLELQQLKQFERLEQEVSRPIEHDLANWT
PAQPLAPGRTGSLGSSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVAHSK
FVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPAAA
QDMVDRVKELGHSTQQFRRVLGQLAAA
Download sequence
Identical sequences M3YEV2
ENSMPUP00000009859 XP_004754046.1.14098 ENSMPUP00000009859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]