SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009902 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009902
Domain Number 1 Region: 640-776
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.32e-36
Family Synaptotagmin-like (S variant) 0.0033
Further Details:      
 
Domain Number 2 Region: 786-917
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.04e-26
Family Synaptotagmin-like (S variant) 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000009902
Domain Number - Region: 9-44
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00604
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009902   Gene: ENSMPUG00000009977   Transcript: ENSMPUT00000010062
Sequence length 953
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896995.1:236490:358375:-1 gene:ENSMPUG00000009977 transcript:ENSMPUT00000010062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFKMIDLSFLTEEEQEAIMKVLQRDAALKRVEEERVRHLPEKIKDDQELKNMSGQWFYE
AKAKRHRDRIHGADIIRASMRKKKPQVAAEQSKERANEAKESWVNNVNKDAFLPPELTGA
VGEPEDVAPASPSASMVSPASTVMDTLQENRRKSAVSPAKQRKNPFNSSKLPEDQLSQQT
KSEPSTDGKADFFQTPKEGELSESKEDSSIPETSSQNLEKTKQTFPGPENRSQVKAPIPK
ARKMLPKSQELKLNDNQSFPRQRTDSLSTRGPPRGILKRNSSSSSTDSETVRFHQNLEPK
TKMVAPGLTIHERISEKEHSLEGDSSSNSLEPLKHVRFSAVKDELPQRPGLSRGREVGEF
SVLESDRLKNGTEDDVDVDEFCNDPQPSQYRKPLPLHQSASNLTASKNEKHQPMASGSFP
VNGHHSPSEVLAARPESIENSSTINEHKAKPSELSQLESELSKSPADGLSCVEPEPFQVP
DHSSRDRQQGSEEEPSPVLKTLERSAARKMPSKSLEDISSDSPNQAKVDNLPEELVRSAE
DDQKTDQEPDTNECIPGISTVPSPPDNPFSHPDKLKRMSKSVPAFLQDESDDRETDTASE
SSYQFSRHKKSPSSLTNLSSSSGMTSLSSVSGSVMSVYSGDFGNLEVKGNIQFAIDYVDS
LKELHVFVAQCKDLAAADVKKQRSDPYVKTYLLPDKGKMGKKKTLVVKKTLNPVYNEILR
YKIEKQILKTQKLNLSVWHRDTFKRNSFLGEVELDLETWDWDNKQNKQLKWYPLKRKTAP
IALEAENRGEMKLALQYVPEPIPGKKLPTTGEVHIWVKECLDLPQLRGSHLNSFVKCIIL
PDTSRKSRQKTRAVGKTTNPVFNHTMVYDGFRPEDLTEACVELTVWDHYKLTNQFLGGLR
IGFGTGKSYGTEVDWMDSTSEEVALWEKMVNSPNTWIEATLPLRMLLIAKISK
Download sequence
Identical sequences M3YEZ5
ENSMPUP00000009902 ENSMPUP00000009902 XP_004763575.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]