SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009925 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009925
Domain Number 1 Region: 20-166
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.26e-25
Family PLC-like (P variant) 0.043
Further Details:      
 
Domain Number 2 Region: 1228-1260
Classification Level Classification E-value
Superfamily Eferin C-derminal domain-like 0.0000000000222
Family Eferin C-derminal domain-like 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009925   Gene: ENSMPUG00000010000   Transcript: ENSMPUT00000010085
Sequence length 1268
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896962.1:1872372:1906170:1 gene:ENSMPUG00000010000 transcript:ENSMPUT00000010085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLAASAGRGPGSVWSPTHVQVTVLQARGLRAKGPGGTSDAYAVIQVGKEKYATSVSERS
LGAPVWREEATFELPPLLSAGAAPAAAATLQLTVLHRALLGLDKFLGRAEVDLRELHRDQ
GRRKTQWYTLKSKPGKKEKERGAIEVDIQFMRNNMTASMFDLSMKDKSRNPFGKLKDKIK
GKHKDSVSDTASAIIPSVTPSADSDDESPSKDKKKKSKIKTLFSKSNLQKTPLSQSMSVL
PTSKSDRVLLRPGDFPSRWEDEDNEDDSPSASDVMSHKRTGSADAKQLNQVNFSLPRKEG
LSFLGGLRSKNDVLSRSNVCINGNHVYMEQPEAKSETKDSTPSSSPSPQGFRKKHLFSST
ENLAPRSWKEPGDGGAVSSDRWFSESSTKDSPKTMSLPSYRPHGSGDIRENVAPAGLEAA
KETKESKKQENKKSSLLSLVTGKKDVAKGSEGGSPPTVLGKEKEGGPLEVRARDDRPGPD
EGLLKRTEKDTLAVVSERGKSLNPFEEVQITEPEADREPKSEAAPPVGSARAPQTKAVKP
RLDVSPEAQPTARLSSSPDSPVFFSALLSSSGQTPVPSKLGHGTETPSSESPSVFSFSSP
IVAPISTSTPVENWPSTDKGQARPEEPSLPLKAELPRESLIEVSKTVSGVSGSLSRKLPT
PACKGTEDSPTRKTSEIGPESTVGNDSEKSLVKQSEMGHQEEVLGFTASERDSVPSSQEA
QEVTFGLSLQSGQIESPAGKHLMRASTGSESPSVSFGETSLQEDSMTSAVTAAVPPLQMG
EPAPPLGSVMRRHEENVGESRKKIRKHVSFSEQLFTQEELEQAAGSVEEDRRHPRELTCK
GVAAGNASDGESAEAAEREAVSPAAQCGVPASVAGPLPGPSCEEKGSEAPMSEAGSGKDI
PLLRIEPEDVLMAPNQSKASDHEGLLSKPLSGLHSTPGVNSPVVADLGLTLPSIPEVASD
DERVDQVEDNGETVQVAAQEGGPSSLSLSPARSEMEKGPRGEADGWAAPAEGPHDPGSKA
PKTSAAASPEPTAASGIHKPDPGKSSWLDKQLPGPGGGEREKLMGNGRPSQPPDPALDSP
VASPSFSENFPVTRSFPGCPHADTHTSTAESQKKATAEGPAGKVESSGKRKPLLQAWVSP
SETLPISAQPSAGTGSAKHRLHPVKPMNTTATKIASSSLGTATITNENLINETAMKKYNP
SDPAFAYAQLTHDELIQLVLKQKETISKKEFQVRELEDYIDNLLVRVMEETPNILRVPAQ
VGKKAGKM
Download sequence
Identical sequences M3YF18
ENSMPUP00000009925 XP_004758304.1.14098 ENSMPUP00000009925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]