SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009935 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009935
Domain Number 1 Region: 608-1049
Classification Level Classification E-value
Superfamily RNI-like 1.47e-86
Family 28-residue LRR 0.00000132
Further Details:      
 
Domain Number 2 Region: 11-90
Classification Level Classification E-value
Superfamily DEATH domain 1.53e-20
Family Pyrin domain, PYD 0.0036
Further Details:      
 
Domain Number 3 Region: 204-380
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000799
Family Extended AAA-ATPase domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009935   Gene: ENSMPUG00000010010   Transcript: ENSMPUT00000010095
Sequence length 1059
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897214.1:565146:595990:-1 gene:ENSMPUG00000010010 transcript:ENSMPUT00000010095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRAPVSHGLCRLSAYLEELEAVELKKFKLYLGTEAEAGRIPWGRLETAGPLDTAQLLVA
HYGPDAAWPLALGLFQRISRRDLWERGLREDLVRDTAPGGPSSLGSQSACSLEVFPGAPT
RDPQETYRDYVRRKFRLMEDRNARLGECVNLSHRYTRLLLVKEHSNPMWAQQKLLDTSWG
QARTVGHQTSFIQLETLFEPDEERPEPPRTVVLQGAAGMGKSMLAHKVMLDWADGRLFQD
RFDYVFYINCREMNQSTAEQSAQDLISSCWPEPSVPLRELVRVPERLLFIIDGFDELKPS
FHDPRGPWCLCWEEKRPTELLLCSLIRKKLLPELSVLITTRPTALEKLHRWLEHPRHVEI
LGFSEAERKEYFYKYFHNTEQAAQVFHFVRDNEPLFTLCFVPMVCWVVCTCLKQQLEDGG
LLRQTSRTTTAVYMLYLLSLMQPKPGSPTLQPPLNQRGLCSLAADGLWNQKILFEERDLR
KHGLDGADVSSFLNMNIFQKDINCEKFYSFIHLSFQEFFAAMYYLLDPGEAGASPELTVA
RLLVEYGFSERSFLALTVRFLFGLLNEETRSYVEKSLCWTVSPHVKAELLRWIQRKAQSE
GSTLQQGSLELFSCLYEIQEEDFIQQALSPFQVVVVSNMATRMEHLIASFCVKSCRNALV
LRLHGAAYSTDEDDGGRWASGPQMPPAQSAEKNLLPEAYSKQLAAALSTKPNLTELVLSR
NALGSRGIRLLCQGLRHPGCKLQNLSLKRCCVASSACQDLAATLMASRTLTRMDLSCNGL
GLPGVRLLCEGLRHPRCRLQVIQLRKCQLEAGACQEIASVLSINQHLLELDLTGNALEDL
GLRFLCQGLKHPICRLRILWLKICHLTAAACEDLASTLRVNQSLMELDLSLNDLGDPGVL
LLCEGLRCHQCRLQTLRLGICRLSSAACEGFCTVLQINHHLRELDLSFNDLGDTGMWPLC
KGLRHPTCRLEKLWLDSCGLTAKACEDLSSTLGVNQTLRELYLTHNTLGNGGVRLLCKGL
SHPGCKLQVLWLFGMDLNKMTQRRLAALRLTKPHLDIGC
Download sequence
Identical sequences M3YF28
ENSMPUP00000009935 ENSMPUP00000009935 XP_004779884.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]