SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009956 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009956
Domain Number 1 Region: 190-261
Classification Level Classification E-value
Superfamily SAND domain-like 6.28e-16
Family SAND domain 0.012
Further Details:      
 
Domain Number 2 Region: 285-354
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000031
Family PHD domain 0.0033
Further Details:      
 
Domain Number 3 Region: 438-487
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000443
Family PHD domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009956   Gene: ENSMPUG00000010031   Transcript: ENSMPUT00000010116
Sequence length 559
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896984.1:7200922:7214843:1 gene:ENSMPUG00000010031 transcript:ENSMPUT00000010116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAGGDAVLRRLLRLHRTEIAVAVDSAFPLLHALADHDVVPEDKFQETLRLKEKEGCPQAF
HALLSWLLTQDAAAILDFWRVLFKDYNLERYARLQPILDGFPKDVDLTQPRKARKPPTGP
KAPVLLPRPPTKRKAPEEPRVALPVASSPRGTSSPGSQAKAKPSKKPESNAEPQRLPPGT
GIQTMATSVQRAMTVSSGDVPGACGAVEGILIQQVFESGGGKKCIQVGGEFYTPSKFEDP
SGGKSKTRGSGLKTLVRAKGPQASALQGGGEPRAGQQGRALAAPALPSEPQPHQKNEDEC
AVCRDGGELICCDGCPRAFHLACLSPPLRDIPRPLAGGHGSSGTWRCSRCLQARAPPDLP
RAEEPPPPEPRAEPPVLLGLRLTGEEAKGLSRETLVGVDTAVPYKHLPAPPSAAPLPVLD
PSALRPLLCVGPEGQQGPAGARCGVCGDGSDALRCAHCAAAFHWRCHFPGAVARPGAVPR
CRSCSGDAAPAPEEGATAPNPARALLGPTKAGDSSAGHEPVLHRDDLESLLSEHTFDGIL
QWAIQSMARPLAEAPTFPS
Download sequence
Identical sequences M3YF49
ENSMPUP00000009956 ENSMPUP00000009956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]