SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009962 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009962
Domain Number 1 Region: 153-283
Classification Level Classification E-value
Superfamily GAT-like domain 5.89e-48
Family Phosphoinositide-binding clathrin adaptor, domain 2 0.000000227
Further Details:      
 
Domain Number 2 Region: 23-148
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.6e-44
Family Phosphoinositide-binding clathrin adaptor, N-terminal domain 0.000000524
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009962   Gene: ENSMPUG00000010037   Transcript: ENSMPUT00000010122
Sequence length 660
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896995.1:460176:569279:-1 gene:ENSMPUG00000010037 transcript:ENSMPUT00000010122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLA
DSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDM
STFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKF
LTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKKIKDSTAASRAT
TLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHSSLTTAASP
VSSSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVLPMSTASQVASTWGD
PFSATVDAVDDAIPSLNPFLTKSSGDVHLPISSDVSTFTTRTPTHEMFVGFTPSPVAQPH
PSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQSLPVAKLPPNKLVSDDL
DSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMNGMHFPQ
YAPPVMAYPATTPTGMIGYGIPPQMGSVPVMTQPTLIYSQPVMRPPNPFGPVSGAQIQFM
Download sequence
Identical sequences M3YF55
XP_004763585.1.14098 ENSMPUP00000009962 ENSMPUP00000009962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]