SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009963 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009963
Domain Number 1 Region: 278-586
Classification Level Classification E-value
Superfamily Folate-binding domain 3.3e-81
Family Aminomethyltransferase folate-binding domain 0.0000603
Further Details:      
 
Domain Number 2 Region: 2-81,186-267
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.59e-23
Family FAD-linked reductases, N-terminal domain 0.0084
Further Details:      
 
Domain Number 3 Region: 83-185
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 7.06e-19
Family L-aminoacid/polyamine oxidase 0.045
Further Details:      
 
Domain Number 4 Region: 588-681
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.000000000000687
Family Aminomethyltransferase beta-barrel domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009963   Gene: ENSMPUG00000010038   Transcript: ENSMPUT00000010123
Sequence length 702
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896939.1:12311514:12331283:1 gene:ENSMPUG00000010038 transcript:ENSMPUT00000010123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVPEDAVVSSADVALALASAASQNGVQIYDRTSVLHVMVKKGQVTGVETDKGQIECQYF
VNCAGQWAYELGLSNEEPVSIPLHACEHFYLLTRPLETPLQSNTPTIVDADGRIYIRNWQ
GGILSGGFEKNPKPIFTEGKNQLEIQNLQEDWDHFEPLLSSLLRRMPDLETLEILKLVNC
PETFTPDMRCIMGESPSVRGYFVLAGMNSAGLSFGGGAGRYLAEWMVHGSPSENIWELDL
KRFGALQSSRTFLRHRVMEVMPLLYDLKVPRWDFQTGRQLRTSPLYDRLDAQGARWMEKH
GFERPKYFVPPDKDLLALEQSKTFYKPDWFEIVESEVKCCKEAVCVIDMSSFTKFEITST
GDQALEVLQYLFSNDLDVPVGHIVHTGMLNQGGGYENDCSVARLSKRSFFMISPTDQQVH
CWAWLKKHMPEDSNLLLEDVTWKYTALNLIGPRAVDVLSELSYAPMTPDHFPSLFCKEMS
VGYANGIRVMSMTHTGEPGFMLYIPIEYALHVYNEVMSVGQKYGIRNAGYYALRSLRIEK
FFAFWGQDLNTLTTPLECGRESRVKLEKGMDFIGRDALLQQKQNGVYKRLTMFILDDHDT
DLDLWPWWGEPIYRNGQYAGKTTSSAYSYTLERHVCLGFVHNFSEDTGEEQVVTADFINR
GEYEIDIAGHRFQAKAKLYPVTSLFTHKRRKEDVELSDLHGK
Download sequence
Identical sequences M3YF56
ENSMPUP00000009963 ENSMPUP00000009963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]