SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009967 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009967
Domain Number 1 Region: 303-506
Classification Level Classification E-value
Superfamily vWA-like 3.44e-20
Family Integrin A (or I) domain 0.017
Further Details:      
 
Domain Number 2 Region: 162-263
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.87e-19
Family Synaptotagmin-like (S variant) 0.012
Further Details:      
 
Domain Number 3 Region: 18-148
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.71e-18
Family Synaptotagmin-like (S variant) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009967   Gene: ENSMPUG00000010042   Transcript: ENSMPUT00000010127
Sequence length 557
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896986.1:6929366:7414308:1 gene:ENSMPUG00000010042 transcript:ENSMPUT00000010127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKMSNIYESAANTLGIFNSPCLTKVELRVACKGISDRDALSKPDPCVILKMQSHGQWFE
VDRTEVIRTCINPVYSKLFTVDFYFEEVQRLRFEVHDISSNHNGLKEADFLGGMECTLGQ
IVSQRKLSKSLLKHGNTAGKSSITVIAEELSGNDDYVELAFNARKLDDKDFFSKSDPFLE
IFRMNDDATQQLVHRTEVVMNNLSPAWKSFKVSVNSLCSGDPDRRLKCIVWDWDSNGKHD
FIGEFTSTFKEMRGAMEGKQVQWECINPKYKAKKKNYKNSGVVILNQCKIHKMHSFLDYI
MGGCQIQFTVAIDFTASNGDPRNSCSLHYIHPYQPNEYLKALVAVGEICQDYDSDKMFPA
FGFGARIPPEYTVSHDFAINFNEDNPECAGIQGVVEAYQSCLPKLQLYGPTNIAPIIQKV
AKSASEETNTKEASQYFILLILTDGVITDMADTREAIVHASHLPMSVIIVGVGNADFSDM
QMLDGDDGILRSPKGEPVLRDIVQFVPFRNFKHASPAALAKSVLAEVPNQVVDYYNGKGI
KPKCSSEMYESSRTLAP
Download sequence
Identical sequences M3YF60
ENSMPUP00000009967 XP_004762563.1.14098 ENSMPUP00000009967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]