SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009978 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009978
Domain Number 1 Region: 118-383
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.06e-65
Family Protein kinases, catalytic subunit 0.000000919
Further Details:      
 
Domain Number 2 Region: 394-438
Classification Level Classification E-value
Superfamily SH3-domain 0.00000517
Family SH3-domain 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000009978
Domain Number - Region: 601-634
Classification Level Classification E-value
Superfamily UBA-like 0.00907
Family UBA domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009978   Gene: ENSMPUG00000010053   Transcript: ENSMPUT00000010138
Sequence length 664
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896973.1:6797153:6802169:-1 gene:ENSMPUG00000010053 transcript:ENSMPUT00000010138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPEASSMWLLRLLRDIQLAQFYRPILEELTVTRPEHFDFVRPEDLDGIGMGRPAQRRLT
EALKKHRSGLKSKNWVYKILGGLAPEQKDTTSDPDSPLSLPEPEGGLKCLIPDGAVCRGE
LLGSGCFGVVHRGLWTLPGGQSVPVAVKSLRVGPEGPVGTELGDFLREVSVMMNLEHPHV
LRLHGLVLGQPLQMVMELAPLGSLHARLTAPAPTPPLPVALLCLFLRQLAGAMAYLGARG
LVHRDLATRNLLLASPRTVKVADFGLVRPLRGARGRYVMGGPRPIPYAWCAPESLRQGAF
SSASDVWMFGVTLWEMFSRGKEPWAGVPPYLILQRLEQDRARLPRPPLCSRALYAVALRC
WALHPADRPSFSYLEGLLQEAWPPEGRCVQDVMEPGALMMQTGDLITIIEGSPDSATWKG
QNGRTLKVGSFPASAVTLADGGGPPATRLVQRVSPAQGERQQGSGNGDRGKAKLQDLPPA
RAQRRNRNVPLQRMKVLSKSLESVLSLGPRPTGGGSSPPELRHARAVPQGPPGLPSRTPF
ASSPSQPSQPPRERPPWPKREPPHSQPSGARATGKATIPSGGLLPDPELQRRVMEVELSV
HGVTHQECQAALRATGGDVVSAIRNLKVEQLYHLSSRSRADCRRILEHYQWDLSAASRYV
LARP
Download sequence
Identical sequences M3YF71
ENSMPUP00000009978 ENSMPUP00000009978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]