SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009985 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009985
Domain Number 1 Region: 6-258
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.91e-95
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000423
Further Details:      
 
Domain Number 2 Region: 259-458
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 1.31e-61
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000158
Further Details:      
 
Domain Number 3 Region: 597-760
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 9.81e-40
Family AlaX-like 0.039
Further Details:      
 
Domain Number 4 Region: 515-593
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000000177
Family AlaX-M N-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009985   Gene: ENSMPUG00000010060   Transcript: ENSMPUT00000010145
Sequence length 968
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896939.1:12388816:12414451:-1 gene:ENSMPUG00000010060 transcript:ENSMPUT00000010145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPS
HPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALE
LLTQEFGIPVERLYVTYFGGDEAAGLEPDLECKQIWQNLGLDDSKILPGNMKDNFWEMGD
TGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNRESDGILKPLPKKSIDT
GMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYSGKVGADDADGIDMAYRVLAD
HARTITVALADGGRPDNTGRGYVLRRILRRAVRYSHEKLNASRGFFATLVDVVVQSLGDA
FPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDCKTIPGDTAWLLYDTYGF
PVDLTGLIAEEKGLVVDMDGFEEERKLAQLKSQGKGAGGEDLIMLDIYAIEELREKGLEA
TDDSPKYNYHSDSSGSYAFESAVATVMALRRDKMFVEEVCTGQECGVVLDKTCFYAEQGG
QIYDEGYLVKVEDNSEDKTEFTVKNAQVRGGYVLHIGTVYGSLRVGDQVRLFIDEPRRRP
IMSNHTATHILNFALRSVLGEADQRGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANQMI
EAAKPVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPSGPAGSLTSI
EFCGGTHLRNSSHAGTFVIVSEEAIAKGIRRIVAVTGAEAQKALRKAESLKNSLSVMEAK
VKAQTAPNKDVQREIADLGEALATAVIPQWQKDEFRENLKSLKKIMDDLDRASKADVQKR
VLEKTKQLIDSNPNQPLVILEMESGASAKALNEALKLFKTHSPQTSAMLFTVDNEAGKIT
CLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDVSAQATGKNVGCLQEALELATSFAQ
LRLGDVKN
Download sequence
Identical sequences M3YF78
XP_004754080.1.14098 XP_012912475.1.14098 ENSMPUP00000009985 ENSMPUP00000009985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]