SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010000 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010000
Domain Number 1 Region: 145-452
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.16e-76
Family Transglutaminase core 0.000000903
Further Details:      
 
Domain Number 2 Region: 3-143
Classification Level Classification E-value
Superfamily E set domains 3.22e-41
Family Transglutaminase N-terminal domain 0.00013
Further Details:      
 
Domain Number 3 Region: 588-686
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.52e-27
Family Transglutaminase, two C-terminal domains 0.0013
Further Details:      
 
Domain Number 4 Region: 475-586
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.14e-20
Family Transglutaminase, two C-terminal domains 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010000   Gene: ENSMPUG00000010075   Transcript: ENSMPUT00000010160
Sequence length 692
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896926.1:9793178:9815433:-1 gene:ENSMPUG00000010075 transcript:ENSMPUT00000010160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQALGIKNCDFQAAKNNEEHHTKAISSRHLIVRRGQPFTIILHFQAPVYAFTSNLKKVA
LIAQTGEHPSKANKTQAIFPISHLGDQKWWNAAVEDRDDQSWAISVTAPADAIIGHYSLL
LQVLGKKQLHLGQFTLLFNPWAREDAVFLKKESQRREYVLNQNGLIYLGTAECFHAEPWD
FGQFESSVINLSLRLLSVDKQVEEWGNPEHVACILGALLHALKEKSVLPPTKAATAQEGA
LLSKRRGSVPILRQWVTGQGRPVYDSQAWVFAAVACTVLRCLGIPARVITTFTSAQGTGG
RLLVDEYYNEEGLQNGEGQGGRIWIFQTSTECWMTRPALPPGYDGWQILYPCVSNGGGVL
GSCDLTPVKAVKEGTLSLTPGVSDLFAAVNASCVVWKCREDGALELTNSNTKYVGNNIST
KGVGSNRCEDITQNYKYPEGSLQEKEVLEKVQEERMRHEKDSGIHPPSLKTAELLHIFLE
VPCSLNLGGEAQYSVKLVNLSDQEKAVQLTSALQAIYYNGILAAELWKRKQSLMLGPKAN
IITSNLSFSHFEQSPPENSFLRLTVMATAMHSESSLSCFAQEDIVICRPHLTIEMPETAE
QYQLLKASVQLHNFLDAPLKDCVISLFGRGLIHRERRYRLASVWPGNILYTEFQFTPTQV
GLQRLTVEMDCDMFQNVTNYRNITVEAPELPA
Download sequence
Identical sequences M3YF93
ENSMPUP00000010000 ENSMPUP00000010000 XP_004751276.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]