SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010010 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010010
Domain Number 1 Region: 147-463
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.16e-126
Family Transglutaminase core 0.00000000821
Further Details:      
 
Domain Number 2 Region: 3-146
Classification Level Classification E-value
Superfamily E set domains 3.43e-42
Family Transglutaminase N-terminal domain 0.00019
Further Details:      
 
Domain Number 3 Region: 618-716
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 8.89e-28
Family Transglutaminase, two C-terminal domains 0.00026
Further Details:      
 
Domain Number 4 Region: 505-616
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.4e-25
Family Transglutaminase, two C-terminal domains 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010010   Gene: ENSMPUG00000010085   Transcript: ENSMPUT00000010170
Sequence length 719
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896926.1:9823051:9854037:-1 gene:ENSMPUG00000010085 transcript:ENSMPUT00000010170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQGLEVVLTDLQSSQNNVRHHTDEISSDRLLVRRGQSFNLTLYFRSRGFQPDLDNIIFV
VETGPLPDLSNGTRALFSLTGRHGPSPWIASLETNGASSMEVSLCAPPVAPVGRYLLKVH
IDSFQRSVTAYQLGEFILLFNPWCPDDSVYLDSEPQRQEYVVNDYGFIYQGNKNWIRPCP
WNYGQFEENIIDICLELLDKSLNFQIDPATDCALRASPVYLSRVVCAMINSNDDNGVLNG
NWSENYLDGVNPAEWTGSVAILKQWHAAGCQPVRYGQCWVFAAIMCTVMRCLGIPTRVIT
NFDSGHDTDGNLIIDEYYDSTGRILENKKKDSVWNFHVWNECWMARKDLPPGYGGWQVLD
ATPQETSNGLYCCGPASVRAIKEGEVELNYDTAFAFSMVNADCMSWLVYGGKEQKIHRDT
NTVGNFISTKSIQSDERDDITENYKYIEGSPQERQVFLKALQKLKAGRSEDPHQADSQYS
TPEPRSGDGLRGLNTPSLRPSDVVQVSLKFQLLDPPHMGQDIRFVLLALNMSLQFKDLKV
NLSAQSLLHDGSPLPPFWQDTAFITLSPEEAKTHSCRIPYSQYSQYLSTDKLIRINALGE
EKSSPEKILVDKIITLAYPGIIINVLGAAVVNQPLSIQVLFSNPLSEYVEDCVLTMEGSG
LFKKQQRVLIGVLKPQHRASITLETVPFKSGQRQIQANLRSNKFKDIKGYKNVYVDLML
Download sequence
Identical sequences M3YFA3
XP_004751280.1.14098 ENSMPUP00000010010 ENSMPUP00000010010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]