SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010015 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010015
Domain Number 1 Region: 311-717
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.22e-112
Family Phosphofructokinase 0.00000853
Further Details:      
 
Domain Number 2 Region: 1-318
Classification Level Classification E-value
Superfamily Phosphofructokinase 2.35e-96
Family Phosphofructokinase 0.000000548
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010015   Gene: ENSMPUG00000010091   Transcript: ENSMPUT00000010176
Sequence length 751
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896984.1:7223966:7242803:1 gene:ENSMPUG00000010091 transcript:ENSMPUT00000010176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAAVRAVTRMGIYVGAKVFLIYEGYEGLVEGGENIKQANWLSVSNIIQLGGTIIGSARC
KAFTTREGRRAAAYNLVQRGITNLCVIGGDGSLTGANIFRNEWGSLLEELVAAGKISEST
AQTYSHLSIAGLVGSIDNDFCGTDMTIGTDSALHRIMEVIDAITTTAQSHQRTFVLEVMG
RHCGYLALVSALASGADWLFIPEAPPEDGWEYLMCERLGETRSRGSRLNIIIIAEGAIDR
HGKPISSRYVKDLVVQRLGFDTRVTVLGHVQRGGTPSAFDRILSSKMGMEAVMALLEATP
DTQACVVSLSGNQSVRLPLMECVQVTKEVQKAMDEKRFDEAIQLRGRSFENNWNIYKLLA
HQKLSKEKTNFSLAILNVGAPAAGMNAAVRSAVRSGISQGHTVYVVHDGFEGLAKGQVQE
VSWHDVAGWLGRGGSMLGTKRTLPKSYLEKIVENIRAHNIHALLVIGGFEAYEGVLQLVE
ARGRYEELCIVMCVVPATISNNVPGTDFSLGSDTAVNAAMESCDRIKQSASGTKRRVFIV
ETMGGYCGYLATVTGIAVGADAAYVFEDPFNIQDLKANVEHMTEKMKTDIQRGLVLRNEK
CHEHYTTEFLYNLYSSEGKGVFDCRTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWMSEK
LRAVYRNGRVFANAPDSACVIGLRKKAVAFSPVTELKKDTDFEHRMPREQWWLNLRLMLK
MLAHYRISMADYVSGELEHVTRRSLSIDKGF
Download sequence
Identical sequences M3YFA8
ENSMPUP00000010015 ENSMPUP00000010015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]