SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010018 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010018
Domain Number 1 Region: 146-463
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.87e-120
Family Transglutaminase core 0.00000001
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily E set domains 8.75e-44
Family Transglutaminase N-terminal domain 0.00018
Further Details:      
 
Domain Number 3 Region: 606-703
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.44e-25
Family Transglutaminase, two C-terminal domains 0.00056
Further Details:      
 
Domain Number 4 Region: 484-604
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.92e-24
Family Transglutaminase, two C-terminal domains 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010018   Gene: ENSMPUG00000010094   Transcript: ENSMPUT00000010179
Sequence length 708
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896926.1:9861197:9874023:-1 gene:ENSMPUG00000010094 transcript:ENSMPUT00000010179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVAALELRSVDLQSPRNNKEHHTQEMGLRRLIVRRGQSFGLQLHFNRPFHFGTDYLTFVA
ETGPAPKELLGTRATFSLTQARKGNVWSAFDFTIDTNSLLVALFTPANAVIGPYTLKLEI
SQGQSHSVVHPLGTFILLFNPWNAEDDVYLPSEILLQEYIMMDYGFVYKGHERFITAWPW
NYGQFEEDIIDICFEILNKSLYFLENPSKDYSQRNDPVYICRVVSAMINSNDDSGVLQGN
WGEDYSRGVSPLEWNGSVAILRQWSARGRQPVKYGQCWVFAAVMCTVMRCLGVPTRVVSS
FRSAHNMDGNLTIDTYYDQNAEMLPTRKRDKIWNFHVWNECWMIRKDLPPGYNGWQVLDP
TPQQTSSGLFCCGPASVKAIREGEVHLPYDTPFVYAEVNADEVIWLFGNGQAQEILVHNT
SSIGKEISTKMVGSDQRQNITSSYKYPEGSPEERSVFMKASRKMLAPRRASSPFLDLLGS
GGPEDQPAQLQLHLARTPEWGQDLMLTLRAWRVPDRVHSRGSISLVVRFSAQALLHQGGT
REPLWRQTVHLNLDFGKEIQLPLLLPYDNYRNKLTDEKLIRVSGIAKVEDTGRSMLVLKD
ISLEPPHLSIEVSKRAEVGKALSVHITLTNTLTVALSNCTMVLEGSGLIDGQISKNIGTL
VAGHTIQIQVDLYPIKTGRRQLQVLISSKEIKEIKGYRDIFVAASRAS
Download sequence
Identical sequences M3YFB1
ENSMPUP00000010018 ENSMPUP00000010018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]