SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010030 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010030
Domain Number 1 Region: 6-413
Classification Level Classification E-value
Superfamily Ras GEF 5.36e-102
Family Ras GEF 0.00028
Further Details:      
 
Domain Number 2 Region: 484-544
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.28e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00099
Further Details:      
 
Domain Number 3 Region: 412-497
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000156
Family Calmodulin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010030   Gene: ENSMPUG00000010106   Transcript: ENSMPUT00000010191
Sequence length 692
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897010.1:3598481:3708024:-1 gene:ENSMPUG00000010106 transcript:ENSMPUT00000010191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSGLGKAATLDELLRTCIEMFDDNGELNNSYLPRIVLLMHRWYLSSTELAEKLLCMYQ
DASGETCDEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHISLIDI
SSIPSYDWMRRVTQRKKVSKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYV
IHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPQQRAEVITKFINVAKKLLQLKNFNT
LMAVVGGLSHSSISRLKETHSHLSSEVTKNWHEMTELVSSNGNYCSYRRAFADCEGFKIP
ILGVHLKDLIAVHVIFPDWTEDNKVNIVKMHQLSVTLSELVSLQNASHHLEPNMDLINLL
TLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPTKPVVPLEWASGVMPKPDPTVINKH
IRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLR
AKSQLHCKMGPGFVHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLL
VLACRRLTRAPSLGSSHGSLPGSPSLPPVQDEVFEFPGVAAGHRDLDSRAITLVTGSSRK
ISVRLQRATTSQATQTEPIWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRV
QAGVDVVDRGTEFEPDQDEADAGETRQDGEDG
Download sequence
Identical sequences M3YFC3
ENSMPUP00000010030 XP_004765521.2.14098 XP_004765522.2.14098 XP_004765523.2.14098 XP_004765525.1.14098 ENSMPUP00000010030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]