SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010033 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010033
Domain Number 1 Region: 1569-1811
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.99e-52
Family Ankyrin repeat 0.00000128
Further Details:      
 
Domain Number 2 Region: 910-1044
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000008
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 3 Region: 473-588
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000942
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 762-800
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000191
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 5 Region: 337-474
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000314
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 152-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000482
Family EGF-type module 0.011
Further Details:      
 
Domain Number 7 Region: 583-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000748
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 672-804
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000116
Family Growth factor receptor domain 0.0052
Further Details:      
 
Domain Number 9 Region: 271-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000168
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 188-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000073
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1246-1277
Classification Level Classification E-value
Superfamily Notch domain 0.000000196
Family Notch domain 0.0025
Further Details:      
 
Domain Number 12 Region: 230-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000215
Family EGF-type module 0.021
Further Details:      
 
Domain Number 13 Region: 804-927
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000267
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 14 Region: 1040-1084
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000365
Family EGF-type module 0.01
Further Details:      
 
Domain Number 15 Region: 1209-1239
Classification Level Classification E-value
Superfamily Notch domain 0.00000693
Family Notch domain 0.0069
Further Details:      
 
Domain Number 16 Region: 27-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000242
Family EGF-type module 0.021
Further Details:      
 
Domain Number 17 Region: 61-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000911
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000010033
Domain Number - Region: 1127-1165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00015
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 114-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000161
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 1168-1197
Classification Level Classification E-value
Superfamily Notch domain 0.00235
Family Notch domain 0.0031
Further Details:      
 
Domain Number - Region: 1082-1119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00344
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 316-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 620-651
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0203
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010033   Gene: ENSMPUG00000010109   Transcript: ENSMPUT00000010194
Sequence length 1993
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897273.1:81778:104731:1 gene:ENSMPUG00000010109 transcript:ENSMPUT00000010194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPSLLLLLLCHSVVKTRVLHCGDSPEPCANGGTCLNLSQGQGTCQCAPGFLGETCQFP
DPCLDAQLCQNGGSCQALLPTLPGSPSLPSPLAPSFSCTCLSGFTGQRCQAQLKDPCSSF
CSKMGRCHIQASGRPQCFCLPGWTGEQCQLQDFCSANPCINGGVCLATHPQIQCLCPPGF
EGHACQHDINECFLDPGPCPKGTSCHNTLGSFWCLCPTGREDPHCDLQPGPCPSSGCSNG
GTCQLFPGRDSTFHLCLCPQGFTGPDCEENSDDCAGHQCQNGGTCQDGLGTYSCLCPEAW
TGWDCSEDVDECEAPGPPRCRNGGTCQNSAGSFHCVCVSGWGGTGCEENLDDCIAATCAP
GSTCIDRVGSFSCLCPPGRTGLLCHMEDMCLSQPCHGEAQCSTNPLTGSTLCLCQPGYSG
PTCHQDLDECQMAQQGPSPCEHGGSCLNTPGSFDCLCPPGYTGSRCEADHNECLSQPCHP
GSTCLDLLATFHCLCPPGLEGQLCEVETDECASAPCLNQADCHDLLNGFRCECLPGFTGS
QCEEDINECGSSPCANGGQCQDQPGSFRCECLPGFEGPRCEAEVDECLSGPCPAGTSCLD
LPGAFFCLCPSGFTGHVCEVPVCVPNLCQPTRKCQDREDKAQCLCPDGNPGCAPIEGNCT
CHHGHCHRSSCVCDVGWTGPECEAELGGCISMPCAHGGTCQPQPSGYNCTCPPGYTGPTC
SEEVTACHSGPCLNGGSCSPRPGGYSCTCPLSHTGPRCQTSTDHCASDPCLNGGTCVNRP
GTFSCLCAAGFQGPHCEERTRPSCADNPCRNRATCQDGPQGPHCLCSPGYTGGSCQSLMD
LCALKPCPHNSHCLQTGPSFQCLCLQGWTGPLCNLPLSCQKAALSQGTEVSSLCQNGGVC
LDRGSSYFCRCPPGFQGSICQDRVDPCESRPCQHGATCIAQPSGYLCQCAPGYSGQNCSK
ESNACQSQPCHNHGTCTPKAGGFYCTCPPGFVGLRCEGDVDECLDRPCHPTGTAACHSLA
NAFFCQCLPGYTGQWCEVETDPCQSQPCSHGGSCETIVGPPLGFTCHCPQGFEGPTCSHR
APSCGLHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPHGCGPPSPCLHNGSCS
EIPGLGTPGFRCSCPPSSPGPRCQRPGAKECEGRGGDGACDAGCSGPEGNWDGGDCSLGV
PDPWKGCPSHSQCWLLFRDGQCHPQCDSAECLFDGYDCETPPACTPAYDQYCHDHFHNGH
CEKGCNTAECGWDGGDCRPKDGDSEWGPSLALLVVLSPPALDQQLLALARVLSLTLRVGL
WVRKDSDGKDMVYPYPGPQAEEELGGTLDISHQERATLHTQPVGKETDSLSTGFVVVMGV
DLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEHLLPGPLLAAHPRAGTAPPTNQLPW
PVLCSPAAGVLLLALGALLVLQLIRRRRREHGALWLPPGFIRRPRTQPAHHRRRPPLGED
SIGLKALKPEAEVDEDGVVMCSGPEEGEEAEETASPSKCQLWSLSSDCQELPQAAMLTPP
QESEMDVPDVDTRGPDGVTPLMSAVCCGGVESRTFQGAWLGSPEPWEPLLGGGACPQAHT
VGTGETPLHLAARFSRPMAARRLLEAGANPNQPDRAGRTPLHTAVAADAREVCQLLLRSR
QTAVDARTEDGTTALMLAARLAVEDLVEELIAAQADVGARDKWGKTALHWAAAVNNARAA
RSLLQAGADKDAQDSREQTPLFLAAREGAVEVAQLLLGLGAARGLRDQAGLAPGDIARQR
NHWDLLTLLEGAGSLEARHKTTPGRGAGPFPRSRTASGSLPPRGGGAPSRCRTLSAGAPP
RGVGACLQAQTLSVEWAARGGGAYSHCQGLSKGGAGGSLRPGARRFSAGMRGPRPNPTIV
QGRSGVASGSGGGASADDWPCDWVTLGPCGPTSNTPIPPLCLTPSPERGSPQVAWGPPTH
QVIPLSAESEGQE
Download sequence
Identical sequences M3YFC6
XP_004780931.1.14098 ENSMPUP00000010033 ENSMPUP00000010033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]