SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010040 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010040
Domain Number 1 Region: 4-288
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.54e-65
Family BAR domain 0.0021
Further Details:      
 
Domain Number 2 Region: 409-522
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.23e-41
Family Pyk2-associated protein beta ARF-GAP domain 0.0002
Further Details:      
 
Domain Number 3 Region: 261-362
Classification Level Classification E-value
Superfamily PH domain-like 1.61e-26
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 
Domain Number 4 Region: 587-693
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.62e-24
Family Ankyrin repeat 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010040   Gene: ENSMPUG00000010117   Transcript: ENSMPUT00000010202
Sequence length 740
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896973.1:6817299:6829013:-1 gene:ENSMPUG00000010117 transcript:ENSMPUT00000010202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVKLDFEECLKDSPRFRASIELVEAEVSELETRLEKLLKLGNGLLESGRHYLAAGRTFV
AGICDLARLGPPEPMMAECLDKFTESLNHKLDSHAELLDATQHTLQQQIQTLVKEGLRGF
REARRDFWRGAESLEAALIHNAEVPRRRAQEAEEAGAALKTARAGYQGRALDYALQINVI
EDKRKFDIMEFVLRLVEAQATHFQQGHEELGRLARYRRELGAQLHQLVLNSARERRDMEQ
RHVLLKQKELGGEEPEPSLKEGPSGLLMEGHLFKRASNAFKTWSRRWFTIQSNQLVYQKK
YKDPVTVVVDDLRLCTVKLCPDSERRFCFEVVSPSKSCLLQADSERLLHRWVSAVQSSIA
SAFSQARLDDSPRGPGQGSGYLASGSSATLGCGGMARGREPGGGGHVAAQVQGVDGNAQC
CDCREPAPEWASINLGVTLCIECSGIHRSLGVHFSKVRSLTLDSWEPELVKLMCELGNVV
INQIYEARVEALAVKKPGPSCSRQEKEAWIHAKYVEKKFLTKLPEIRGRRGGRGPPKGQP
PLPPKPSVRPRPGSLRSRPEPPSEDLGSLHPGALLFRAAGNPPSLPTMADALAHGADVNW
VNAGQENATPLIQATAANSLLACEFLLQNGANVNQVDNHGRGPLHHATILGHTGLACLFL
KRGADLGARDSEGKDPLTIAMETANADIVTLLRLAKMREVEAAQGQAGDETYLDIFRDFS
LMASDDPEKLSRRSHDLHTL
Download sequence
Identical sequences M3YFD3
XP_004760382.1.14098 ENSMPUP00000010040 ENSMPUP00000010040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]