SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010064 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010064
Domain Number 1 Region: 162-409
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.98e-68
Family Nuclear receptor ligand-binding domain 0.00000000155
Further Details:      
 
Domain Number 2 Region: 94-176
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.99e-29
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010064   Gene: ENSMPUG00000010141   Transcript: ENSMPUT00000010226
Sequence length 492
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896985.1:2758197:2832087:-1 gene:ENSMPUG00000010141 transcript:ENSMPUT00000010226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHHPSLAFPNFPTRLKAQQPSHTLACGGTCMCVSKSMMRVSEPILDMEMANYSEVLDPTY
TTLEFETMQILYNSNDSSAPETTSMNTTDNGVNCLCAICGDRATGKHYGASSCDGCKGFF
RRSIRKSHVYSCRFSRQCVVDKDKRNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTF
DGSNIPSINTLAQAEIRSRQISVSSPGSSTDINVKKIASIGDVCESMKQQLLVLVEWAKY
IPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVYKDILLLGNNYVIHRNSSEVEISRVA
NRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPVKIKNMRFQVQLSLEDYIND
RQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQEMLLGGASNDASHL
HHPMHPHLSQDPLTGQTILLGPMSTLVHTDQISTPETPLPSPPQGSGQEQYKIAANQASV
ISHQPLSKQKQL
Download sequence
Identical sequences M3YFF7
ENSMPUP00000010064 XP_004762383.1.14098 ENSMPUP00000010064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]