SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010076 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010076
Domain Number 1 Region: 194-511
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.63e-87
Family Protein kinases, catalytic subunit 0.0000000361
Further Details:      
 
Domain Number 2 Region: 41-156
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.11e-37
Family Synaptotagmin-like (S variant) 0.00000985
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000010076
Domain Number - Region: 1-28
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000314
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010076   Gene: ENSMPUG00000010153   Transcript: ENSMPUT00000010238
Sequence length 569
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897214.1:653875:666715:1 gene:ENSMPUG00000010153 transcript:ENSMPUT00000010238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHVTVGEARNLIPMDP
NGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRLSVEVWDWD
RTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQKFEACNYP
LELYERVRMGPSSSPIPSPSPSPTDSKRCFFGTSPGRLHISDFSFLMVLGKGSFGKVMLA
ERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQLHSTFQTPD
RLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRDLKLDNVML
DAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFGVLLYEM
LAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPAKRLGSGPDGEPAI
RAHGFFRWMDWERLERLEIAPPFRPRPCGRSGENFDKFFTRAAPALTPPDRLVLASIDQA
DFQGFTYVNPDFVHPDARSPVSPPPVPVM
Download sequence
Identical sequences M3YFG9
ENSMPUP00000010076 ENSMPUP00000010076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]