SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010096 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010096
Domain Number 1 Region: 341-519,546-658
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.67e-50
Family Extended AAA-ATPase domain 0.00000329
Further Details:      
 
Domain Number 2 Region: 132-224,261-315
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.67e-26
Family Ankyrin repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010096   Gene: ENSMPUG00000010173   Transcript: ENSMPUT00000010258
Sequence length 709
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897030.1:4096884:4236706:1 gene:ENSMPUG00000010173 transcript:ENSMPUT00000010258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGSLVLRKTAPAPRLLLQLLRSSSLRSHGSASSSSVTTAGRGQPQWLRAAVGGRPGTSP
AFLPHEGAATWGRQGGLTETSCLLAATSGRLPSPEETLPGQDSWNGVPSRAGLSIWALAT
ALVVHCYSKNPSNKDAALMEAARTNNVQEVSSLQNPPGSLITAALSSTPPPAHRDVLVSY
GNLRLLSEGADVNARHRLGWTALMVAAISRNDSVVQILLAAGADPNLGDDFSSVYKTAKE
QGIHSLEVLVTREDDFNNRLNNRASFKGCTALHYAVLADDYRTVKELLDGGANPLQRNEM
GHTPLDYAREGEVMKLLRTSEVKYQEKQRKREAEERRRFPLEQRLKEHIIGQESAIATVG
AAIRRKENGWYDEEHPLVFLFLGSSGIGKTELAKQTAKYMHKDAKKGFIRLDMSEFQERH
EVAKFIGSPPGYIGHEEGGQLTKKLKQCPNAVVLFDEVDKAHPDVLTIMLQLFDEGRLTD
GKGKTIDCKDAIFIMTSNVASDEIAQHALQLRQEALEMSRNRIAENLGDVQINDKITISK
NFKENVIRPILKAHFRRDEFLGRINEIVYFLPFCHSELIQLVNKELNFWAKRAKQRHNIT
LLWDREVADVLVDGYNVHYGARSIKHEVERRVVNQLAAAYEQDLLPGGCTLRITVEDSDK
QLLKSPELPSPQAEKRPPKLRLEIIDKDSKTRKLDIRAPLHPEKVCHNL
Download sequence
Identical sequences M3YFI9
ENSMPUP00000010096 ENSMPUP00000010096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]