SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010108 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010108
Domain Number 1 Region: 91-198
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000183
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Domain Number 2 Region: 508-571,626-654
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000143
Family Second domain of FERM 0.0093
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000010108
Domain Number - Region: 400-495
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000878
Family Ubiquitin-related 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010108   Gene: ENSMPUG00000010185   Transcript: ENSMPUT00000010270
Sequence length 794
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897072.1:3387319:3395193:1 gene:ENSMPUG00000010185 transcript:ENSMPUT00000010270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPGGLWWLLCCRRGFTLLHRDYGDGELSGDGDEDEDEETFELRTPSPAGGGRGPLDVT
LTQPVRSAQVSDRLQSWEETRSLIPEKGPPEEDPDVVVKGWLYGEPRGGGARPWLPPRRA
WFVLTRDSLDQFSSSGKGARRLRSLVLTSLCSVTGPERRPKETGLWSVTVSGRKHSVRLC
SPRQAEAERWGLALREVIASKAPLETPTQLLLRDIQESCGDPEAVALIYRRNPILRHTSG
ALYAPLLPLPYGVSAPGPGYAPLREEAVRLFLALQALEGARRPGPLMQGVLQTCRDLPAL
RDELFLQLAKQTSGPAGPPGPPATQDPAALRYWQLLTCMSCTFRPGGAVRGHLLGHLERT
EQALPDTELAEYARFIRKALGRTRGRELVPSLAEISALSQRQELLCTVHCPGAGACPVAI
DSHTTAGEVARELVGRLGLARSRNAFALYEQRGAQERALAGGTLVADVLTRFENLAVEEA
GLDDSPDSGWRLCLRLHGPLHPEGLSPDGHELPFLFEQAHALLLRGRPPPPDDTLRALAA
LRLQSLHRDFSPRAPLPRLDRLLPPSAPPRDDPPRPVPRPPPSAALLAGAIWSPGLAKRR
GARTRPGGGAGGPAGSAAREGGGGMGTAAAVLGGWKRLRGMGRAEAMAAYLALAAQCPGF
GAARYDVLELSTEPGGGTPQKLCLGLGAKAMSFSRPGETEPIHSVSYGHVAACQLMGPHT
LALRVGESQLVLQSPQVEEIMQLVNAYLPNPSPERPCSSPSPPCQDLPDTSPPSQHPGLD
EPQGQSGCLGQLQD
Download sequence
Identical sequences M3YFK1
XP_004772726.1.14098 ENSMPUP00000010108 ENSMPUP00000010108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]