SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010133 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010133
Domain Number 1 Region: 167-275
Classification Level Classification E-value
Superfamily TPR-like 3.38e-17
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000010133
Domain Number - Region: 30-135
Classification Level Classification E-value
Superfamily TPR-like 0.000359
Family Tetratricopeptide repeat (TPR) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010133   Gene: ENSMPUG00000010209   Transcript: ENSMPUT00000010295
Sequence length 303
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897220.1:591458:621071:-1 gene:ENSMPUG00000010209 transcript:ENSMPUT00000010295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WGPRYLASPESPGXGAADETEAEIIQLLKRAKLSIMKDEPEEAELILHDALRLAYQSDNK
KAITYTYDLMANLAFIRGQLENAEKLFKATMSYLLGGGMQQEDNAIIEISLKLASIYAAQ
NRQEFALAGYEFCISTLEEKIEREKELAEDVLSVQEKASTHLLLGMCLDTYARYLLFSKQ
PSQAQRMYEKALQISEEMLGERHPQTIVLMSDLATTLDAQGRFDEACAYVQRASDLARQI
EHPELHMLLSNLAAILMHRERYAQAREIYQEALKQAELKRDEVSIQHIREELAELSRKSR
PLT
Download sequence
Identical sequences M3YFM6
ENSMPUP00000010133 ENSMPUP00000010133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]