SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010149 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010149
Domain Number 1 Region: 58-259
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.0000000000475
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010149   Gene: ENSMPUG00000010224   Transcript: ENSMPUT00000010311
Sequence length 3190
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896962.1:8174901:8233517:1 gene:ENSMPUG00000010224 transcript:ENSMPUT00000010311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATNKMEMKEIAKHKTLWKMNSTGEPLLVTGVEVNPLKKFTIPKIRRTAGKVYLSSCCTN
TREYSFIHDTLTQCQLDLGCDLQSSWRFGDTKLVHNEELEKNFTSKRSEMRESGRHGREL
EEHFCFLALPQNDVAEIYQNGISTRTSTLKILGNPLLGIYVFRHVDVALNYARSRSITVE
SIIIFKVLFGKVKKIQPSVDKNKVSLDPSPNFDCHMSRSIPSLKDTIELQAYNSAVYFYE
YNVLSKPVDKPRQCLPYAILTVKFIGQKVDNGHLMTSLRFLSTGFPKRAERTCSLNNCTV
AKRIGKGKDATVIFEHFRKPVDPFVQENCSCSAVNSEINPSNENISNSYGNVQNGNISIH
ETYSGQMEHNLAECRDTSQVHIYDSGLSFFPSDTRESVNGDFMLNLTQLKNVLSGLSAAF
PLHNNIGSSTVITSKLIKDPRLMKREESIGKHNNITGLNKILPLEKSLDFNSEEHLSSTQ
NNSAFSSEVVPGDRSILTNCLDAPCFKVSFDDSQSQAQNWGSKNYDYTTPGKITMARQCK
GQDNFSFPMCLPNAVSEVENQKHNEEKVQRSQQRGNISLLIEEEGEPRNSHESVNTCTEG
YSSHISQKSWSSNLETVYQTGQQMSTVFPLQKKESIRGYLQNIGKMRDFTSPEDNSEHGE
KQILWKENDFTNEAKIRPVDNYISLHQEYKENESLCSFRKNCDQIPITQELEIPKSSAFT
TKDKYDLDHLALELESNLTPRVESLSQKHSQPSLEYEDNIHTSFAISQKLMELKLEKPNQ
NSVNIMTNALQEAKDIPQDKELPNDRITSSHDIKTTHDNSDCSIAGEHTCVHENDPVSLE
NMQKDCRETFQNANKGQGHTLCCNAELYSDIHLNTDFKEQGDNDKENENEAKEEDTALST
ENNRLDIYEDEKQGFRTDKNYAIIDERRENENYNNVEILSSEEFCTFNLTWGKRHVSTET
TFLESEDTITAIKQKDSQNTSRSVEHLASTTLPKIAASSVHVASNAAVQITGDMVPTLGT
NHEDHQRYQIKETCSSESLDVGLLVKHKVSDCEMDVDNNKFHDSFFQSVSDSRILQSCEL
ENKIELGSELCDDVFLIQQNTPSHRNALYEEFGASYEALKSRIDWEGLLESNNGEREVLK
SSRGRENNDQHYSEESNSSYSSTQKDKELFNPILLPDLQVKITNVFMPGFTPTFESPALE
DNFCKNITKTKEPEMDEEEKLPGFEIYSQCSGEYSHHPCENESGNTSQESGLVSKSEISL
SLDANHNTQGNHASEKQNSGPLLTEPSNVTALSNERSCSLTNSKTDCNDTRSKKDTGSRI
SKRKPNTPFRNENTAHKDLKHHEIYGKKRKLTDQDSSECFSSLSQGRIKTFSKSEKHIRS
VLDILNSEASLCKSKRLSRKLDRAVLHLKKAHRRVHTSLQLIAKVGEKRKGPLPKSYAII
CNNFWESCDLQGYSSVSERRYYSTKHFLSKRKYDRPGEKRALGFEVGKSLTHVSKHKSFK
TSRERITECVSKKNVASSVSRSHTTIHVREFCEKEYPESQLALCSTPQSTSYSAYNKSSM
KSLRSSELQPFSGKPGFLFSPSCPDKLTKKNKIDTTFLSNISKYEKPEYHSANNKIKDLM
KESNSETNKSINKSNSVSLNCIKENNVSFSRDKNYDATCITHTKVKTDIVISVLESNVKH
FLNVDIYKPDNLILSGYKRNLEVTFPIEEWTAPTQSSKPGIIAGDMLMDPLNPTLVTHKK
YNSVPQLLTTTPVTASEGESSESYLDRQRTFSVDSFATSTNVPHCQPRCGGKECLKTEQW
SSSNCFHIDENDSGVLENSELGLKLVTEESKSCRKKTMKKLFSNDSSLLLKGNMKCSSSK
KCMAKTDIQDRKMWKVKHAEKAKDSLHIKTMTEGFTATKYKNQKNKILEDSSYLCEKRIK
NNVIDSHQIFEDITEVVSLNNTVSNHLSKREKEGEVKVSNNSQSDSALHSEIACNSKPHI
TGMNHRPVLHMHSQTSESSTEKKPASNVNGLKEKYCSADHSSLIPRLAQILRRADETSSF
QILQEETKACQSILPLFVEAFERKQECSHEQILISRELLVEQNLWNNCKHKLKPCAIDSL
VELQMMLETIQFIENKKRLLGGEPTFRSLLWYDETLYGELLGRPRGFQQQSNFYPAFQGR
LKYNAFCELQNYHDQLIELFEETKRENNSYYAFLKYKRQINECEAIMKHCSDCFDFSLSV
PFTCGVNFGDSLGDLETLRKSTLKLIGMYGDSPKVDSYPGKQDHLWIIIEMISSKVNFIK
NNEAVSIKISLYGLEHIFFDAAKSLVWKERRQSFSKKYSGKKDKEMLLKMNQYAFSKLKN
IYDTLSKDLSSEQISNIGLENTEIASRKSDDLINKATVNMEDCRFNSTLLSHPDICCVSE
ILDQAGFADSEKLEELTLRCIGHLEILKKYFQMLQEENIDHIFITEENVLDMVKNHNHGA
IILKPAAIETYIEIVMLSETVHFLKNTMAKKLDKQRFRGMLWFDLSLLPELVCCQEKMAP
FSFLKDNSTDCLWNVIETAISELKKDLDIIYKYSEGINCSYALHLLSRELAELSEIKKLL
EMSKYSVSTYIDFVPYIASINYGSTMTELEYNYNQFSTLLKNIMAAPQKDLGKMAHIMKV
MKTIEHMKIICAKNAELTISFILCQMLHNRKKTLQLKRKEKMNMHVKPRKSISKSSTFMK
VPSISECIMKNVSNSSKKRSITVDKCEDSQEQEKNSTVSSCKKQKVDMKDVTEINREEAT
FKHPRTMRSHPESPREIGATSSDNLKRNHVSQKKIEVERSLPDSLLPSKNLKDTCTSKPE
DRIDLTNISSNTSKDLTGQQGNLSSMKKSNANFSAPETKTDKKACSSFTICEQRSVDGVF
PKDCKMPSQRFLNPAEKFCPSNIKPGTEPDGSVLSKPVFRFVRDIPANIETNDTVFELQD
YEILNSSIKNSACTNSSESRFNQDKSPILQVNKTQPEKTELKEKYMDTLSPSSIPLGASE
DITLNVNQTAEYSFSEQQNNENPKVLTQNAAAYWNELPQSACAPICSSSAYAFGTSYPYY
AWCVYHYSSSGSSSLTQTYRGITYEVQPPPPGMLTAIASTVQSSHSNLLYSQYFGYFAGE
RQASDFLPVNGYFQSQMPVPYNFQQPVFSQYAPHQSFPQPVYPYPPDSGVLPEVPWTYVP
WQQEPFQPGH
Download sequence
Identical sequences M3YFP2
ENSMPUP00000010149 XP_004758348.1.14098 ENSMPUP00000010149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]