SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010168 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010168
Domain Number 1 Region: 578-870
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.63e-79
Family Protein kinases, catalytic subunit 0.0000251
Further Details:      
 
Domain Number 2 Region: 418-532
Classification Level Classification E-value
Superfamily PH domain-like 2.61e-34
Family Pleckstrin-homology domain (PH domain) 0.0000236
Further Details:      
 
Domain Number 3 Region: 130-205
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.94e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0007
Further Details:      
 
Domain Number 4 Region: 257-322
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.5e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010168   Gene: ENSMPUG00000010243   Transcript: ENSMPUT00000010330
Sequence length 890
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897010.1:4557029:4635848:-1 gene:ENSMPUG00000010243 transcript:ENSMPUT00000010330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSANNSPPSAQKSVLPATLPAVLPAPSPCSSPKTGLSARLSNGSFSAPSLTNSRGSEHTI
SFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPECGFFGMYDKILLFRHDMNSEN
ILQLITSADEIHEGDLVEVVLSALATVEDFQIRPHTLYVHSYKAPTFCDYCGEMLWGLVR
QGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPGPGLSVPRLIQTEYVALPTEES
HVHQEPSKRIPSWSGRPIWMEKMVMCRVKVPHTFAVHSYTRPTICQYCKRLLKGLFRQGM
QCKDCKFNCHKRCASKVPRDCLGEVTFNGEPSSLGADTDIPMDIDSSDMNSDGSRGLDDT
EEPSPPEDKMFFLDPSDLDVERDEEAVKTISPSTSSNIPLMRVVQSIKHTKRKSSTMVKE
GWMVHYSSRDTLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRISSPQDFTNISQG
SNPHCFEIITDTMVYFVGENNGDSSHNPVLAATGVGVDVAQSWEKAIRQALMPVTPQASV
CTSPGQGRDHKDLSTSISVSNCQIQENVDISTVYQIFADEVLGSGQFGIVYGGKHRKTGR
DVAIKVIDKMRFPTKQESQLRNEVAILQNLHHPGIVNLECMFETPERVFVVMEKLHGDML
EMILSSEKSRLPERITKFMVTQILVALRNLHFKNIVHCDLKPENVLLASAEPFPQVKLCD
FGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIVYVSLSGTFPFNEDE
DINDQIQNAAFMYPPNPWREISGEAIDLINNLLQVKMRKRYSVDKSLSHPWLQDYQTWLD
LREFETRIGERYITHESDDARWEIHAYTHNLVYPKHFIMAPNPDDMEEDP
Download sequence
Identical sequences M3YFR1
ENSMPUP00000010168 XP_004765542.1.14098 ENSMPUP00000010168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]