SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010187 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010187
Domain Number 1 Region: 1712-1862
Classification Level Classification E-value
Superfamily BRCT domain 1.32e-45
Family 53BP1 0.0000000706
Further Details:      
 
Domain Number 2 Region: 1864-1968
Classification Level Classification E-value
Superfamily BRCT domain 2.36e-39
Family 53BP1 0.00000222
Further Details:      
 
Domain Number 3 Region: 1535-1603
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.02e-31
Family Tudor domain 0.0000123
Further Details:      
 
Domain Number 4 Region: 1481-1534
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.58e-18
Family Tudor domain 0.0000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010187   Gene: ENSMPUG00000010262   Transcript: ENSMPUT00000010349
Sequence length 1969
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896926.1:9994802:10072781:-1 gene:ENSMPUG00000010262 transcript:ENSMPUT00000010349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGEQMDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFSMLSRHLPNLQTHKE
NPVLDVVSNPEQTAGEEQGDSNSGFNEHLKENKAAEPMDSSHLDTCSSISQVIEQLPQPN
RTSSVLGISVESAPPVGEEKEEDMEEEEEEKEEDTRDGTITHSLGAEDSASSQLGFGVLE
LSQSQDVEEHTVPYEVAKEPPLSVTTNSTYTRLSDVDANTGSKHEEQSIEDTPTAEQPSK
GVPVAAQPSKDVHVVEEQNSPPGRSEESPKVSLAAVETNERVTAQELLQGGLKIQKSPEP
EVLSTQEDLFDQSNKTASDGCSTPSREEGGCSLASTPATTLHVLQLSGQRSLAQESLSTN
SSDLVAPSPDAFRSTPFIVPSSPTEQEGRKDEPMDMSVLSEGKGESFEKKLENDEPVETE
NPPLPPESTVSPQASTPVSQSTPVFTPGSLPIPSQPEFSHDIFIPSPSLEERSSDGKKGG
DLHSSSLTVECSKTSETEPKNATEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHRIDE
DGENTQIEDTEPMSPVLNSKLAPAENDNILMNPAQDGQVELNQNDKTRGDDTETRDDIGI
LASGCKGREETVAEDVCIDLTCDSGSQAVPSPATRSEALSSVLDQEEAMEIKEHHPEEGS
SGSEVEEIPETPCESQGEEPKGENTESVPLHLSLTETQSQAFCLPKEIPKQECQEAMEVE
TSVISIDSPQKIPVPDQELEHKDQEAWEEVTSEDSSVVIVDVKEPSPRVDVSSEPLEGVE
KCSDSQSWEDDAPEIEPCAENRADAQEGKSAEYEGDLKSVTAEKEPVEVHSSQPPLTLER
AGDALGPDLEMQQAEPPEKTDNSLTKDSKIANAKQLGSSVEAPELEKGSAHASQSFCESS
SETPFHFTLPKEGEIIPPLTGATPPLIGHLKLEPKRHSTPIGISNYPESTIATSDVMSES
MVESNDPILGNVKGDLGAAPEMDDKLCLKMKLVSPVTETSEESLQFSLEKPTTGERKNGS
TAVAEAVASSPKTVSVFSCVCEAQQDDEARSQNPPSVPMRGNSLSFPSTQDEEEKEKLEG
EQRTRKSQQPMKPSCPVKDPPSPVSQQVATQGPSSPQGEAMETDVLEGQNTNQEKPSNAL
TERPSQNNIGIQTIERSLWVPETVSAATQTVKNVCEQGTSTVDQNSGKQDATVQTERGTG
EKPVSAPGDDTESLHSQGEEEFDMPQPPHGHVLHRHMRTIREVRTLVTRVITDVYYVDGT
EVERKVTEETEEPIVECQECETEVSPSQTGGSSGDLGDISSFSSKASSLHRTSSGTSLSA
MHSSGSSGRGAGPLKGKTSGTEPADFALPSSRGGPGKLSPRKGVSQTGAPVCEEDGDAGL
GIRQGGKAPVTPRGRGRRGRPPSRTTGTREAAVPGPLGIEDISPSMSPEDKSFTRIVPRV
PDSTRRADVGAGALRRSDSPEIPFQAAAGPSDGLDASSPGNSFVGLRVVAKWSSNGYFYS
GKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRK
ESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLGPYEAVTPLTKAADISLDNLV
EGKRKRRSNISSPATPAASSSSSTTPTRKTTESPRASSGVPSGKRKLITSEEERSPAKRG
RKSATVKPGAVGAGEFVSPCESGDNMGEPSALEEQRGPLPLNKTLFLGYAFLLTMATTSD
KLASRSKLPDGPTGSSEEEEEFLEIPPFNKQYTESQLRAGAGYILEDFNEAQCNTAYQCL
LIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQ
PRENPFHNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTD
PSCPASVLKCAEALQLPVVSQEWVIQCLIVGERIGFKQHPKYKHDYVSH
Download sequence
Identical sequences M3YFT0
ENSMPUP00000010187 ENSMPUP00000010187 XP_004751297.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]