SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010211 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010211
Domain Number 1 Region: 116-201
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.22e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010211   Gene: ENSMPUG00000010285   Transcript: ENSMPUT00000010373
Sequence length 286
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897072.1:3466370:3471278:-1 gene:ENSMPUG00000010285 transcript:ENSMPUT00000010373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLRPPPPVLGLVGLGHVDAPRLFLAAGGPPVGWFRFGGSEMTEPGASPDDPWVKVEYA
YSDNSLDPGLFVESTRKGSVVSRANSIGSTSASSVPNTDDEDSDYHQESYKESYKDRRRR
AHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKK
KQEEEVSMLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQS
FNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY
Download sequence
Identical sequences M3YFV4
ENSMPUP00000010211 ENSMPUP00000010211 XP_004772735.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]