SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010246 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010246
Domain Number 1 Region: 430-721
Classification Level Classification E-value
Superfamily BEACH domain 5.62e-117
Family BEACH domain 0.0000000612
Further Details:      
 
Domain Number 2 Region: 759-1063
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.68e-56
Family WD40-repeat 0.00074
Further Details:      
 
Domain Number 3 Region: 338-431
Classification Level Classification E-value
Superfamily PH domain-like 5.74e-17
Family PreBEACH PH-like domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010246   Gene: ENSMPUG00000010320   Transcript: ENSMPUT00000010409
Sequence length 1066
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897036.1:1195334:1252311:1 gene:ENSMPUG00000010320 transcript:ENSMPUT00000010409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKHLSPCVQQYKRRGAAGGEKGTLALQGQTAGWPRPCPGPRGPECLGVSERPSSGLSHG
AAGVPTRTCSAERGRDAAGPGAQRRAVGLWGAQRRHRTRSQARARAPLPAGTLQAGSPDP
PPSRVPDSSRTTAAPEPCVSARCPPSMAFIRKKRREQQLQLYSKERFSLLLLNLEEYYFE
QHTADHIQNKGGQYERKIRGSLKICSKSVIFEPDVISQPIIKIPLRDCIKIGKHGENGSN
RHFAKAKSGEISLIFSQVYFIKEHNIVAPYKIERGKMEYVFELDVSGKVEDVVETLLQLH
RASCLDKLGDQTAMITAILQSRLARTSFDKNRFQSVSEKLHMECKAEMVTPLVTNPGHVC
ITDTNLYFQPLNGYPKPVVQITLQDVRRIYKRRHGLMPLGLEVFCTEDDLCSDIYLKFYE
PQDRDDLYFYIATYLEHHVAERTAESYTLQWQRGHLSNYQYLLHLNNLADRSCNDLSQYP
VFPWIINDYCSTELDLSNPGTFRDLSRPVGALNKERLERLLTRYQEMPEPKFMYGSHYSS
PGYVLFYLVRIAPEYMLCLQNGRFDNADRMFNSIAETWKNCLDGATDFKELIPEFYGDDV
SFLVNSLKLDLGKRQGGQTVDDVELPPWARSPEDFLQKSKDALESSYVSEHLHEWIDLVF
GYKQKGSDAVEAHNVFHPLTYEGGVDLNSIEDPDEKVAMLTQILEFGQTPKQLFVTPHPR
RITPKLKTVTQACSPDDPMADSPVSPGEESFEDLTEESKSLAWNNITKLQLQEQYKIHKE
AVTGIAVSCNGSSVFTTSQDSTLKMFSKESKMLQRSISFSNMALSSCLLLPGDATVISSS
WDNNVYFYSIAFARRQDTLMGHDDAVSKICWHDNRLYSASWDSTVKVWSGVPAEMTCTRR
QQFDMLAELEHDVSVDTISLNAASTLLVSGTKEGTVNIWDLTTATILHQIPCHSGTVCDT
AFSPDSRHVLSTGKDGCLNVIDVQTGMLISSLTSDETQRCFIWDGNSVLSGSQSGELLVW
DLLGGKISERIQGHAGAVTCIWMNEQCSSIITGGEDRQIMFWKLQY
Download sequence
Identical sequences M3YFY9
XP_004768844.1.14098 ENSMPUP00000010246 ENSMPUP00000010246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]