SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010272 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010272
Domain Number 1 Region: 1359-1540
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-41
Family DBL homology domain (DH-domain) 0.0000222
Further Details:      
 
Domain Number 2 Region: 1549-1664
Classification Level Classification E-value
Superfamily PH domain-like 2.07e-34
Family Pleckstrin-homology domain (PH domain) 0.00051
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000010272
Domain Number - Region: 694-853
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0116
Family CRAL/TRIO domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010272   Gene: ENSMPUG00000010345   Transcript: ENSMPUT00000010435
Sequence length 1823
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897032.1:6195383:6273286:-1 gene:ENSMPUG00000010345 transcript:ENSMPUT00000010435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLESLDTYIQNTLSALYPPFEATAATVLWQLFSVAERLHGGDGLRCLTDFLIPAKRALQH
LQQEACARYTGLIFVHEGWPLCVREKVVVQLTSLHGVRLRPGDFYLQVTSGRKRSARLVL
KCLSQLGRGSEEVTVPEAMYGCVFTGEFLEWLNGERTSVPLQNCLLTSGSAVFRTPWSSV
TDPIFLPTFRAVPPPDMGSPSSRRRLPRDPASEESKRWFRTSYMEALQNPMPLGSSSEES
LGDEACGSQTTRARTAAGPAPKETPSSWGDSTGIPTPHPSPPMSPTTRTTGKGVHTCSVS
VAATANTADQVTSDTFPVGSGASRMKPRPWQGHSPSRGSSRRAPPTQTSSAHVSLHRAFP
SFLSRGHPALGSASAVHFIMEQCPPCRRCPWTCRLRVPGQGSSTGHAVGRCPRCLASGGG
GFLSSVAWPQNSRLHQLEEMPELEHPAEATAEQATVSSSLPRSTDVGPCSSLTHFPLLRF
APAPEALPCLFFDIKSMNEKALDRVERPEAFLAKTIPPLTGVTQALGVARLGLNLLVLVP
CGSSPVSAAQKHGGAADHKPGPLLSPLSWCTHMSPPLQGGTGDPGPPTLGEGNTTPTAAC
PPGALTPMDIFCDTLWEICVFSTRDGTSSHGTQYLHTRFPPGVCGADADSGPFRRPDPGW
IPDVPEPLCPEGGGQPPSTGDVPSQMPRLVLEVSRELLQSGLLALPGTRDHQGRAVVQVC
TRGPLWSSRHASSAELTRLLLYFHGIPRKEVRELGLVVVVDAREGPAAPALFQALAALQN
TPPPIIHTIVLLVNKESGFRPDKDGAVQCEVVGSLKALHKLVDSSQLTADLDGSFPYSHS
AWICFRRKLEPFTTNCKDAIVFLQNSVLSLNTPRTLSTAQEVTDLIGKHKAMMKCVLEDA
LLVALRLEGGAVLARLRTEQLGTSQDCRDAIEAASRLYDQVDEEVHRLVLASNRCLQELE
RLQGVRALQERQGQVSAPVKEAGRERLSPCTTLSSTFLRERMHGRAFQKLARISRPMCPL
GQSESIFLSLWVIFFSTKTQQPLPQLEASHLQARLTRTLWSCDRYLPQCVTVLCYDGNDL
SYLKVSEQRRHLGTFSLVTSFKMESSVNSLSTHECLELRGPEPGMECVQSCPQEAAELTV
QSFPKASTATVALGGPRMLRQQHPLELQTQPRFQEALSGVGPDPGTPPLDQRALEPELAP
GAERRQCELSWAPPTDPEGRTGKQAQLLPGLPRRAPPCRQETEPLAPAVPSPQDSTPCSP
ERIQTPTTHPRKQPLKKMMRKTRSFEIAQLDSGPRDAPWPGHTGVFIRGLEVTSTMASEK
KPPPRPHAESPLVTRNQSLSSRSKTHLSEEDGRRRAGSSRRQHILAEMVSTEREYVRSLG
YVIDNYFPEMERTDLPQALRGKRSVVFGNLEKLYDFHGQRFLAELEHCQPCPLAAGRGFL
RHEEEFGMYALYSKNKPQSDALLCSHGNAFFKDKQQQLGDKMDLASYLLKPVQRMGKYLL
LLQDLVREAGGCPAGEQELRELQAAADMVRFQLRHGNDLLAMDAVRGCDVSLKEQGPLRC
QDEFIVCCGRRKHLRHVFLFEDLILFSKTRKVEGGYDTYTYKQSFKTAEIGLTENVGDSG
LRFEIWFRRRRKSQDTYILQASSAEVKSAWTHVIGQILWRQALRNRELRMQEMVSMGLGN
KPFMDIQPSDAAISDRSVKKGAELRTRASVAVPLCDHAASFKRPHSTISDSSTSSSGSQS
SSALGPLSPALLSSTHCPWPADLQACFQEEEELEQEPGSPPSLLTEGTSSSGDSGLGLPE
LFSEEGPRRGAQVPTLSQHTTML
Download sequence
Identical sequences M3YG15
ENSMPUP00000010272 ENSMPUP00000010272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]