SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010273 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010273
Domain Number 1 Region: 41-114
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000458
Family HLH, helix-loop-helix DNA-binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010273   Gene: ENSMPUG00000010346   Transcript: ENSMPUT00000010436
Sequence length 137
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897129.1:1126032:1127466:-1 gene:ENSMPUG00000010346 transcript:ENSMPUT00000010436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEGIPHLQERQLLEHRDFIGLDYSSLYMCKPKRSMKRDDSKDTYKLPHRLIEKKRRDRI
NECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNGKSVQ
GGQLPLMNPGSPQRGSV
Download sequence
Identical sequences M3YG16
ENSMPUP00000010273 ENSMPUP00000010273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]