SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010293 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010293
Domain Number 1 Region: 118-207
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.03e-17
Family MHC antigen-recognition domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010293   Gene: ENSMPUG00000010367   Transcript: ENSMPUT00000010457
Sequence length 251
Comment pep:novel scaffold:MusPutFur1.0:GL896937.1:10340178:10342546:-1 gene:ENSMPUG00000010367 transcript:ENSMPUT00000010457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLKDTAFWDTQMEPLEDLGEELRKKLLDIKAEFITKSSKSEGPGQENTLARLWRYCVHV
KLQSGSQQPGQTRRPEQDQEGEGEWRSVQWVGQRIGQHQRLIGQDQRLMCFPWRGMGADS
LTLQGSLMCERGAHGHSRGSWRFVFTEQLIYLFDPENRKWIEISPGGQQVKDMLDGDREL
TELLMKIANGDCKRWLQKLREHSNEMQETTGAPATTLPIALIKGAAIRPITSVLHVVLTH
SILLVVQGMVL
Download sequence
Identical sequences M3YG36
ENSMPUP00000010293 ENSMPUP00000010293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]