SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010303 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010303
Domain Number 1 Region: 28-262
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.4e-76
Family Ecto-ART 0.0000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010303   Gene: ENSMPUG00000010377   Transcript: ENSMPUT00000010467
Sequence length 355
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897030.1:4588066:4591947:-1 gene:ENSMPUG00000010377 transcript:ENSMPUT00000010467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLAALLLALSYLGLHSLWQAQAVPILPLGLAPDTFDDAYVGCAEEMEEKAAPLLKEEMA
RHALLRESWEAAWEAWEHKRHRLTLPPGFRAQHGIAIMVYTNSSNTLYWELNQVVRTGGS
SREFYMRRFPFKALHFYLTRALQLLRGSGGCSKGPGEVVFRGVGTLHFEPRRLGDSVRLG
QFASSSLDEAVARRFGNATFFSLRTCFGAPIQALSVFPEEREVLIPPHEVFLVTRFSQDG
AQSLVTLWSYNQTCSHFNCAYLGGEKRPGCVSAQSEYSSALSLSCFNTSPPTPTQALLTH
HLSFLSSRRTATFRLQGGLLSAFLKDPALGPWGLPALGGWALKAQCLPLRSPRNL
Download sequence
Identical sequences M3YG46
ENSMPUP00000010303 ENSMPUP00000010303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]