SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010309 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010309
Domain Number 1 Region: 37-279
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.77e-71
Family Ecto-ART 0.0000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010309   Gene: ENSMPUG00000010384   Transcript: ENSMPUT00000010474
Sequence length 320
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897030.1:4599320:4603150:1 gene:ENSMPUG00000010384 transcript:ENSMPUT00000010474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTPAMLCLLLVCTGLLEAPQAQSHLISRRDLFSQELPLDMAPASFDDQYEGCAAAMTAA
LPDLNQTEFQANKVYADGWVQASSQWQDRQAWGPEWVLSSTGLPPPPPGFRDEHGVALLA
YTANSPLHKEFNAAVREAGRSRAYYLHHFSFKTLHFLLTEALQLLGRGSSPQCHQVFRGV
HGLRFRPAGPGATVRLGGFASASLKNVAAQQFGEDTFFGIWTCLGVPIKRYSFFPGEEEV
LIPPFETFQVINASRPAQGPVRIYLRALGKHSTYNCEYIKDKQCKSRSCQLGNSAMGQGP
SSSVWSLLLPVWLLVRGTFP
Download sequence
Identical sequences M3YG52
ENSMPUP00000010309 XP_004768233.1.14098 XP_012919838.1.14098 ENSMPUP00000010309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]