SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010329 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010329
Domain Number 1 Region: 185-394
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-62
Family DBL homology domain (DH-domain) 0.0000219
Further Details:      
 
Domain Number 2 Region: 379-520
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-31
Family Pleckstrin-homology domain (PH domain) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010329   Gene: ENSMPUG00000010404   Transcript: ENSMPUT00000010494
Sequence length 1472
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896937.1:10983075:11077507:1 gene:ENSMPUG00000010404 transcript:ENSMPUT00000010494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHSGENPSQGLFSSAQGPQLAGICYNSSAPNAIYGNKLSNNGISPEDVHLLCPQVPSAV
TGTPDRKTSSRRAGAQEPKAMELSDSDRPVSFGSTSSSASSRDSHGSFGSRMTLVSNSHL
GLFHQDKEAGAINLELVPARPFSSSELPRDLPAGPRSTDEGTATPPRAPRRMEAHGASRT
GGPSSATSPKLLYVDRVVQEILETERTYVQDLKSIVEDYLDCIRDQTKLPLGTEERSALF
GNIQDIYHFNSELLQDLENCENDPVAIAECFVSKSEEFHIYTQYCTNYPRSVAVLTECMR
NKMVAKFFRERQETLKHSLPLGSYLLKPVQRILKYHLLLHEIENHLDKDTEGYDVVLDAI
DTMQRVAWHINDMKRKHEHAVRLQEIQSLLTNWKGPDLTSYGELVLEGTFRIQRAKNERT
LFLFDKLLLITKKRDDTFTYKAHILCGNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKS
QQDKRLWVLHLKRLILENHAAKIPAKAKQAILEMDAIHYPGFCYSPDGETKALCGSKNGS
APYRLRRKSEPSSRSHKVLKTSETAQDIQKVSREEGSPQRTSTGPSPAQRNSQPSSSAII
SVLRGGGGIRNIWTDHQIRQALFPSRRSPQENEDDEDDYQMFVPSFSSSDLNSARLCEDS
TSSRPCSWHMGQIEPAEPASSGHRVVRRASSAGESNTCAPEIRIRDSGGSQYSPRREQQG
DPKTEGQDRMTPFGSSIELTLDDIDHVYDNISYEDLKLMVAKREEAEAMSPTTAKDPVRP
KSTPEFAFSKAQPGSEKSSRHAERDGALTGHQAPNQSTHELQMVEENIYDTIGLPDPPSL
DFKCSSLTRPKRSTFLGLEADFACCDSLRPFVSQDSLQFSEDETPYPQRPSDNDYLSLLY
NSFSCNLSLGDKSISDKLSEEVDEIWNDLENYIKKNEVKARDRLLAAFPVSQEDVPDRLH
SESTPELGREAACSASTLSLPEGHAFLTPLRDKPGRAGRTNCPFEEDLITKEGSLMSLNR
LSLASETPTLENPYDLANSSLSQTELENPAPGMDATDKTKSRVFLMARQYSQKIKKANQL
LKVRNPELEQPLASQQPKSSDKDLAAILEEKKQGGPAIGARIAEYSQLYDQIVFRETPSK
PQKDVWASPPETRSPRSPSPSQAQQSSEDWLLHSTYSNGELADFCPRPEPNLKSKHPTPE
TSTKSIPRQLSTACSVPSLPSSDPLLGSVQRHSVIVSQPSQELSLQGYLYNSLGRTGLSG
RCQPYSRSQSSSSILINQSVDSISYPGEGGRKQLLSLGKSPRCESHQDVRPGLADSCQQG
TEKRSDLTLRDSQKVLVVNRSLPLNAQRATQNYFSNFKETGGDEDDYVEIKSEEDEPEAE
LSQGQRKMCDPRAVEAGLSEGACSNHPSYSLNSPCSPKKPVSDKLGMSPYLASYSDPDKL
SDYLWRGPSPNQQNIVQSLREKFQCLSSSSFA
Download sequence
Identical sequences M3YG72
XP_004753616.1.14098 ENSMPUP00000010329 ENSMPUP00000010329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]