SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010331 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010331
Domain Number 1 Region: 254-324
Classification Level Classification E-value
Superfamily Homeodomain-like 2.14e-20
Family Homeodomain 0.0022
Further Details:      
 
Domain Number 2 Region: 97-165
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000428
Family LIM domain 0.016
Further Details:      
 
Domain Number 3 Region: 65-96
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000291
Family LIM domain 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000010331
Domain Number - Region: 161-190
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00302
Family LIM domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010331   Gene: ENSMPUG00000010406   Transcript: ENSMPUT00000010496
Sequence length 397
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896951.1:1776014:1787458:1 gene:ENSMPUG00000010406 transcript:ENSMPUT00000010496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIVGCRAEDNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAVM
PPLSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYC
KEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSL
VYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGVDIV
NYNSGCNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQL
AQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTAT
TLTDLTNPTISVVTSVTSNMDSHESGSPSQTTLTNLF
Download sequence
Identical sequences M3YG74
ENSMPUP00000010331 XP_004756269.1.14098 ENSMPUP00000010331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]