SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010345 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010345
Domain Number 1 Region: 353-487
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.12e-41
Family Synaptotagmin-like (S variant) 0.000006
Further Details:      
 
Domain Number 2 Region: 214-326
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.91e-38
Family Synaptotagmin-like (S variant) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010345   Gene: ENSMPUG00000010421   Transcript: ENSMPUT00000010511
Sequence length 491
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897236.1:357184:560697:-1 gene:ENSMPUG00000010421 transcript:ENSMPUT00000010511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGARDALCHQALQLLAELCARGALEHDSCQDFIYHLRDRARPRLRDPDISVSLLTLVVT
ACGLALFGVSLFVSWKLCWVPWRERGLLSGSKENNREPLNYTDTETNEQENSEGFLDPPT
PCPDASMKISHTSPDIPLSTQTGGQENCAHGVRVQRQVTEPTSSARHNSIRRQLNLSNPD
FNIQQLQKQEQLTGIGRIKPELYKQRSLDTDDGTRGNSKACGKLNFILKYDCDLEQLIVK
IHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVPYNDLAA
RKLHFSVYDFDRFSRHDLIGQVVVEHFLDLADFPRECILWKDIEYVTNDNVDLGELMFSL
CYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYN
EAIVFDVPPENIDQIHLAIAVMDYDRVGHNEIIGVCQVGNEAERLGRDHWSEMLSYPRKP
IAHWHSLVEKR
Download sequence
Identical sequences M3YG88
XP_004780229.1.14098 ENSMPUP00000010345 ENSMPUP00000010345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]