SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010353 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010353
Domain Number 1 Region: 2689-2977
Classification Level Classification E-value
Superfamily BEACH domain 2.62e-126
Family BEACH domain 0.0000000151
Further Details:      
 
Domain Number 2 Region: 3048-3247,3410-3442
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.7e-32
Family WD40-repeat 0.001
Further Details:      
 
Domain Number 3 Region: 2535-2657
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-22
Family PreBEACH PH-like domain 0.017
Further Details:      
 
Domain Number 4 Region: 3450-3518
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 
Domain Number 5 Region: 1083-1287
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000148
Family Trypanosoma sialidase, C-terminal domain 0.085
Further Details:      
 
Domain Number 6 Region: 470-514,580-658,852-910
Classification Level Classification E-value
Superfamily ARM repeat 0.000007
Family Armadillo repeat 0.078
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000010353
Domain Number - Region: 1410-1461,1513-1579,1614-1704
Classification Level Classification E-value
Superfamily ARM repeat 0.000237
Family HspBP1 domain 0.048
Further Details:      
 
Domain Number - Region: 2345-2405
Classification Level Classification E-value
Superfamily Cyclin-like 0.00153
Family Retinoblastoma tumor suppressor domains 0.012
Further Details:      
 
Domain Number - Region: 117-390
Classification Level Classification E-value
Superfamily ARM repeat 0.0144
Family Mo25 protein 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010353   Gene: ENSMPUG00000010429   Transcript: ENSMPUT00000010520
Sequence length 3527
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897202.1:687106:934310:1 gene:ENSMPUG00000010429 transcript:ENSMPUT00000010520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMVKRIMGRPRQEECSPQDNALGLMHLRRLFTELCHPPRHMTQKEQEEKLYMMLPVFNR
VFGNAPPNTMTEKFSDLLQFTTQVSRLMVTEIRRRASNKSTEAASRAIVQFLEINQSEEA
SRGWMLLTTINLLASSGQKTVDCMTTMSVPSTLVKCLYLFFDLPHVPEAVGGAQNELPVA
ERRGLLQKVFVQILVKLCSFVSPAEELAQKDDLQLLFSAITSWCPPYNLPWRKSAGEVLM
TISRHGLSVNVVKYIHEKECLSTCVQNMQQSDDLSPLEIVEMFAGLSCFLKDSSDVSQTL
LDDFRIWQGYNFLCDLLLRLEQAKEAESKDALKDLVNLITSLTTYGVNELKPAGITTGAP
FLLPGFAVPQPAGKGHSVRNIQAFAVLQNAFLKAKTSFLAQIILDAITNIYMADNANYFI
LESQHTLSQFAEKISKLPEVQSKYFEMLEFVVFSLNYIPCKELISVSILLKSSSSYHCSI
IAMKTLLKFTRHDYIFKDVFREVGLLEVMVNLLHKYAALLKDPTQALNEQGDSRNNSSVE
DQKHLALLVMETLTVLLQGSHTNAGIFREFGGARCAHNIVKYPQCRQHALMIIQQLVLSP
NGEDDMGTLLGLMHSAPPTELQLKTDILRALLSVLRESHRSRTVFRKVGGFVYITSLLVA
MERSLSSPPKNGWEKVNQNQVFELLHTVFCTLTAAMRYEPANSHFFKTEIQYEKLADAVR
FLGCFSDLRKISPMNVFPSNTQPFQRLLEEDVISVDTVSPTLQHCSKLFIYLYKVATDSF
DSRAEQIPPCLTSESSLPSPWGTPALSRKRHAYHSVSTPPVYPPKNVADLKLHVATTSLQ
SSDAVIIHPGAMLAMLDLLASVGSVTQPEHALDLQLAVATILQSLVHTERNQQVMCEAGL
HARLLQRCSAALADEEHSLHPPLQRMFERLASQALEPMVLREFLRLASPLNCGAWDKKLL
KQYRVHKPSSLSYEPEMRSSMITSMEGLGSDNVFSLHEDNHYRISKSLVKSAEGSTVPLT
RVKCLVSMTTPHDIRLHGSSVTPAFVEFDTSLEGFGCLFLPSLAPHNAPTNNAVTTGLTD
GAVLSGIGSGERFFPPPSGLSYSSWFCIEHFSSPPNNHPVRLLTVVRRANSSEQHYVCLA
IVLSAKDRSLIVSTKEELLQNYVDDFSEESSFYEILPCCARFRCGELIVEGQWHHLVLVM
SKGMLKNSTAALYIDGQLVNTVKLHYVHSTPGGSGSANPPVVSTVYAYIGTPPAQRQIAS
LVWRLGPTHFLEEVLPPSNVTTIYELGPNYVGSFQAVCMPCKDTKSEGVVPSPVSLVPEE
KVSFGLYALSVSSLTVARIRKVYNKLDSKAIAKQLGISSHENATPVKLIHNSAGHLNGPA
RTVGATLIGYLGVRTFVPKPVATTLQYIGGAAAILGLVAMASDVEGLYAAVKALVCVVKS
NPLASKEMERIKGYQLLAMLLKKKRSLLNSHILHLTFSLVGTVDSGHETSIIPNSTAFQD
LLCDFEVWLHAPYELHLSLFEHFIELLTESSEASKNAKLMREFQLIPKLLLTLRDMSLSQ
PTIAAMSNVLSFLLQGFPNSNDLLRFGQFISSTLPTFAVCEKFVVMEINNEEKLDTGTEE
EFGGLVSANLILLRNRLLDILLKLVYTSKEKTSINLQACEELVRTLGFDWIMMFMEEHLH
STTVTAAMRILVVLLSNQSILIKFKEGLSGGGWLEQTDSVLTNKIGTVLGFNVGRSAGGR
STVREINRDACHFPGFPVLQSFLPKHTNVPALYFLLMALFLQQPVSELPENLQVSVPVIS
SRCKQGCQFDLDSIWTFIFGVPASSGTVVSSIHNVCTEAAFLLLGMLRSMLNSPWQSEEE
GSWLREYPVTLMQFFRYLYHNVPDLASMWMSPDFLCALAATVFPFNIRPYSEMVTDLDDE
VGSPAEEFKAFAADTGMNRSQSEYCNVGTKTYLTNHPAKKFVFDFMRVLIIDNLCLTPAS
KQTPLIDFLLEASPERSTRTQQKEFQTYILDSVMDHLLAADVLLGEDASLPITSGGSYQV
LVNNVFYFTQRVVDKLWQGMFNKESKLLIDFIIQLIAQSKRRSQGLSLDAVYHCLNRTIL
YQFSRAHKTVPQQVALLDSLRVLTVNRNLILGPGNHDQEFISCLAHCLINLHVGSNVDGF
GLEAEARMTTWHIMIPSDIEPDGGYSQDISEGRQLLIKAVNRVWTELIHSKKQALEELFK
VTLPVNERGHVDIAVARPLIEEAGLKCWQNHLAHEKKCISRGEALVPTTQSKLSRVSSGF
GLSKLTGSRRNRKESGLNKHSLSTQEISQWMFTHIAVVRDLVDTQYKEYQERQQNALKYV
TEEWCQIEYELLRERGLWGPPIGSHLDKWMLEMTEGPCRMRKKMVRNDMFYNHYPYVPET
EQEANVASEVPSKQPETPDDIIPQKKPARYRRAISYDSKEYYMRLASGNPAIVQDAIVES
SEGEAAQQEPEHGEDTIAKVKGLVKPPLKRSRSAPDGGDEESQEQLQDQIAEGSSIEEEE
KTDNATLLRLLEEGEKIQHMYRCARVQGLDTSEGLLLFGKEHFYVIDGFTMTATREIRDI
ETLPPNMHEPIIPRGARQGPSQLKRTCSIFAYEDIKEVHKRRYLLQPIAVEVFSGDGRNY
LLAFQKGIRNKVYQRFLAVVPSLTDSSESVSGQRPNTSVEQGSGLLSTLVGEKSVTQRWE
RGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILADYDSEEVDLTNPKTFRNLAKPMGAQ
TDERLAQYKKRYKDWEDPNGETPAYHYGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHFD
LADRMFHSVREAWYSASKHNMADVKELIPEFFYLPEFLFNSNNFDLGCKQNGTKLGDVIL
PPWAKGDPREFIRVHREALECDYVSAHLHEWIDLIFGYKQQGPAAVEAVNVFHHLFYEGQ
VDIYNINDPLKETATIGFINNFGQIPKQLFKKPHPPKRVRSRLNGDSTGASAPLGSTSDK
IFFHHLDNLRPSLTPVKELKEPVGQIVCTDKGILAVEQNKVLIPPTWNKTFAWGYADLSC
RLGTYESDKVVTVYECLSEWGQILCAICPNPKLVITGGTSTVVCVWEMGTSKEKAKTLTL
KQALLGHTDTVTCATASLAYHIIVSGSRDRTCIIWDLNKLSFLTQLRGHRAPVSALCINE
LTGDIVSCAGTYIHVWSINGNPIVSVNTFTGRSQQIVCCCVSEMNEWDTQNVIVTGHSDG
VVRFWRMEFLQVPETPAPEPVEVLEMQEDCPETQIGQEAQDEDSSDSEADEQSTSQDPKD
VPSQPSSSSHRPRAASCRAAAVWCTDSGSDDSRRWSDQLSLDEKDGFIFVNYSEGQTRAH
LQGPLNHPHSNPMEVRNYSRLKPGYRWERQLVFRSKLTMHTAFDRKDNAHPAEITALGVS
KDHSRILVGDSRGRVFSWSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNC
GQLFCQKCSRFQSEIKRLKISSPVRVCQNCYYNLQHERGSEDGPRNC
Download sequence
Identical sequences M3YG96
XP_004779413.1.14098 XP_004779414.1.14098 ENSMPUP00000010353 ENSMPUP00000010353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]