SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010360 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010360
Domain Number 1 Region: 596-783
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.18e-53
Family DBL homology domain (DH-domain) 0.0000000116
Further Details:      
 
Domain Number 2 Region: 788-928
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-38
Family Pleckstrin-homology domain (PH domain) 0.000000226
Further Details:      
 
Domain Number 3 Region: 275-424
Classification Level Classification E-value
Superfamily Spectrin repeat 7.46e-17
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 4 Region: 1082-1137
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000673
Family SH3-domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000010360
Domain Number - Region: 41-193
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000301
Family CRAL/TRIO domain 0.01
Further Details:      
 
Domain Number - Region: 433-525
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0338
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010360   Gene: ENSMPUG00000010436   Transcript: ENSMPUT00000010527
Sequence length 1154
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896915.1:770636:861103:-1 gene:ENSMPUG00000010436 transcript:ENSMPUT00000010527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFWLRREEMAVAEMVRRLNAVCRRADEIMHRDISPLCAADIQDQLKKRFAYLSGGRGQD
GSPVITFPDYPAFSDVPDKEFQNVMTYLTSIPSLQDAGIGFILVIDRRQDKWTSVKASIL
RIAASFPANLRLVLVLRPTGLLQRTLSDLALKFNRDDFNMKVPVIMLSSVPELHGYIDKS
QLTEDLGGTLDYCHTRWLCHRTAIEGFALMVKQTAQMLQSFGTELAETELPNDVPSTTSV
LCAHTEKKDKAKEDMKLALDEGRSLLENIREPLGKCGEQSLNQDQLDNQTTVQRLLDQLT
ETEAAFDEFWAKHEQKLRQCLQLRQFEQDFREVKASLDALAQKIATFTDVGNSRAHAEHL
LKDLASFEDKSSASVERARGLSLEGEQLIDSKHYAVDSIRPKCHELQHLCEQFVAEVERR
RELLSKSLELHHLLEASMKWCDQGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENK
IQELSKIYQDYESILTKDLMEHVQKVFQKQEGMEEMFHRRQASLKKLAAKQMRPVQPVAP
RPEALTKSPCPSPGSRRGSENSSEGSGLRRGPYRRAKSEMSESRPGRSSSTGDEEEGLAI
LRRHVMNELLDTERVYVEELLCVLEGYAAELDNPLMAHLVSPGLQNKKDVLFGNMEEIYH
FHNRIFLRELEGYTDCPELVGRCFLERMEEFQIYEKYCQNKPRSESLWRQCSDSPFFQEC
QRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRSCAGAEHLQEALSSILGVLKTVND
SMHLIAVTGYDGNLSELGKLLMQGSFSVWTDHKKGHSKVKDLARFKPMQRHLFLHEKAVL
FCKRREESGEGYEKAPSYSYKQSLNMAAVGITESVKGDVRKFEIWCNGREEVYIVQAPTP
EVKAAWVSEIRKVLTSQLQACREASQHRALEQSQSLPLPAPPGTSPSKGTTRNIKKLEER
KTDPLSLEGYVSPTSLLKPPEKGRDDSVPSSTSESSALSRKRFTLQGFPNLKGQKASPTS
PDKKAKRHEVKSDPTPFGVRGWTKTSQPSEAPEDDGWSSAEELINSSDAEEEGRVGPRKL
VPGKYTVMLGDEKGSPDAFAVRSGDVVEVVQEGDEGLWYVRNLTSSKESWVPASSLASLL
CTSGSAQCLSSSVW
Download sequence
Identical sequences M3YGA3
ENSMPUP00000010360 ENSMPUP00000010360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]